KEGG   Methanococcus voltae: Mvol_0390Help
Entry
Mvol_0390         CDS       T01251                                 

Definition
(GenBank) Cellulase
Organism
mvo  Methanococcus voltae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
422069..423154
Genome map
AA seq 361 aa AA seqDB search
MSTLDYLKDLATEKGISGNEDNVRNYMRKELEKYADEIYEDNFGNLIAKKGTKGPKIMIA
THMDEIGLMVKYIDDKGFLKFVKIGGINDQMLLNQKVVVHTTKGDIIGVLGSKPPHKMDE
SERNKLIKSDLMFIDVGASNREEAEAMGVEIGTPMSFRTDFDTLGDKRITCKSFDNRAGC
AVLLEAMKQISESNEKDGIECQFYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGD
HPGIKLEDAPVEMGKGPVITIADAAGRGILVSGKVLKMMREINKKVVEGKTETEIPVQYE
VGDGGTTDATAIHLTRDGIPTGVVSVPSRYIHTPVEVIEIEDLENTTKLIIKCLENVHNY
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgtctacattagactacttaaaagatttagcaactgaaaaaggtatttcaggaaatgaa
gacaatgtaagaaattacatgagaaaagaattagaaaaatacgctgatgaaatttacgaa
gataattttggaaatttaattgcaaaaaaaggtacaaaaggacctaaaataatgattgca
acacatatggacgaaattggtcttatggtaaaatacattgatgataaaggtttcttaaaa
ttcgttaaaatcggcggaataaacgaccagatgttattaaaccagaaagtagttgttcac
actacaaaaggggatataatcggtgttttaggttcaaaaccacctcacaaaatggatgaa
agcgaaagaaacaaattaataaaatccgatttaatgtttatcgacgtaggagcttcaaac
agagaagaagctgaggctatgggtgttgaaataggtacgcctatgtcatttagaactgat
ttcgatacgcttggagataaaagaatcacttgtaaatcattcgataatagggcaggttgc
gccgttcttttggaagctatgaaacagatttcagaatcaaacgaaaaagatggaatcgag
tgccagttttatgcagtaggaactgtacaggaagaagttggtttaaaaggggctaaaaca
tccgcatttggaataaaccctgatgtagcatttgctttagatgttacaatctgtggagac
catccgggaattaaattagaggatgcacctgtcgaaatgggtaaagggccagttattaca
atcgcagatgcagccggaaggggcatactcgttagtggtaaagttttaaaaatgatgaga
gaaatcaacaaaaaagtagtggaaggaaaaactgaaactgaaataccagttcaatatgaa
gtgggagacggtggaacaactgatgcaaccgctattcacttaacaagagatggtatacct
acaggagtagtttcagtaccttcaagatacatacacacaccagtggaagttattgaaatc
gaagatttagaaaatactactaaattaattataaaatgtttagaaaatgtacataactat
ttctaa

DBGET integrated database retrieval system