KEGG   Methanococcus voltae: Mvol_0390Help
Entry
Mvol_0390         CDS       T01251                                 

Definition
Cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mvo  Methanococcus voltae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mvol_0390
Enzymes [BR:mvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mvol_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
422069..423154
Genome map
AA seq 361 aa AA seqDB search
MSTLDYLKDLATEKGISGNEDNVRNYMRKELEKYADEIYEDNFGNLIAKKGTKGPKIMIA
THMDEIGLMVKYIDDKGFLKFVKIGGINDQMLLNQKVVVHTTKGDIIGVLGSKPPHKMDE
SERNKLIKSDLMFIDVGASNREEAEAMGVEIGTPMSFRTDFDTLGDKRITCKSFDNRAGC
AVLLEAMKQISESNEKDGIECQFYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGD
HPGIKLEDAPVEMGKGPVITIADAAGRGILVSGKVLKMMREINKKVVEGKTETEIPVQYE
VGDGGTTDATAIHLTRDGIPTGVVSVPSRYIHTPVEVIEIEDLENTTKLIIKCLENVHNY
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgtctacattagactacttaaaagatttagcaactgaaaaaggtatttcaggaaatgaa
gacaatgtaagaaattacatgagaaaagaattagaaaaatacgctgatgaaatttacgaa
gataattttggaaatttaattgcaaaaaaaggtacaaaaggacctaaaataatgattgca
acacatatggacgaaattggtcttatggtaaaatacattgatgataaaggtttcttaaaa
ttcgttaaaatcggcggaataaacgaccagatgttattaaaccagaaagtagttgttcac
actacaaaaggggatataatcggtgttttaggttcaaaaccacctcacaaaatggatgaa
agcgaaagaaacaaattaataaaatccgatttaatgtttatcgacgtaggagcttcaaac
agagaagaagctgaggctatgggtgttgaaataggtacgcctatgtcatttagaactgat
ttcgatacgcttggagataaaagaatcacttgtaaatcattcgataatagggcaggttgc
gccgttcttttggaagctatgaaacagatttcagaatcaaacgaaaaagatggaatcgag
tgccagttttatgcagtaggaactgtacaggaagaagttggtttaaaaggggctaaaaca
tccgcatttggaataaaccctgatgtagcatttgctttagatgttacaatctgtggagac
catccgggaattaaattagaggatgcacctgtcgaaatgggtaaagggccagttattaca
atcgcagatgcagccggaaggggcatactcgttagtggtaaagttttaaaaatgatgaga
gaaatcaacaaaaaagtagtggaaggaaaaactgaaactgaaataccagttcaatatgaa
gtgggagacggtggaacaactgatgcaaccgctattcacttaacaagagatggtatacct
acaggagtagtttcagtaccttcaagatacatacacacaccagtggaagttattgaaatc
gaagatttagaaaatactactaaattaattataaaatgtttagaaaatgtacataactat
ttctaa

DBGET integrated database retrieval system