KEGG   Methanococcus voltae: Mvol_0666Help
Entry
Mvol_0666         CDS       T01251                                 

Definition
FAD-dependent pyridine nucleotide-disulfide oxidoreductase
Orthology
K00384  
thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
mvo  Methanococcus voltae
Pathway
Pyrimidine metabolism
Selenocompound metabolism
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mvo00240]
Metabolism; Metabolism of other amino acids; Selenocompound metabolism [PATH:mvo00450]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(724092..725075)
Genome map
AA seq 327 aa AA seqDB search
MEIGNLKDMVIIGGGPAGLVAGIYAMRGGVNAICIEKENAGGKIAEAGIVENYLGYSQIK
GFELANNFAEHANSLNLPIIHEEVISVVPNAVIIHDENGDNKINYHKVITKNNEYITKTI
VIASGSKYKSLGINEDDYVGKGVGYCVMCDAFFFKDRHVLVIGRNTPAAMAAYNLRDIAK
KITIITDKNEIKVVEKIMMDRLKKIENLEIIYNAKPIEFKGTNKFEGIEVELTEKDSTKE
IKEIKKIINGDGAFIMLGYTPNSEFLQESGINLKKGFVITNKECETNIEGIYACGDITGG
ILQVSKAVGEGVYAFSSASKYLQKFDK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaaattggtaatcttaaagatatggtaattataggtggaggtcctgcaggtcttgta
gcaggtatttacgcaatgcgtggtggagtcaatgcaatttgtattgaaaaagaaaatgct
ggtggtaaaatagcagaagcgggtatcgttgagaattatttgggatattctcaaataaaa
ggttttgaacttgccaataattttgcagaacacgctaatagtttaaatttaccgattata
cacgaagaagtcattagtgtagtgcctaatgcggttataatccatgatgaaaatggggat
aataaaataaattaccacaaggttattacgaaaaataacgaatacattacaaaaaccatt
gtaatagcttcaggtagcaaatataaatctctgggaataaatgaggacgattatgtcggt
aaaggcgttggatactgtgtaatgtgtgatgctttcttttttaaagataggcacgtactt
gtaatcggtagaaatacgcctgcagctatggcggcttacaatttaagagatattgctaaa
aaaattacaataattacggataaaaatgaaattaaagtcgtagaaaaaattatgatggac
aggctcaaaaaaattgagaatttggaaataatatataatgcaaaaccaattgaatttaaa
ggaactaataaatttgaaggtatagaagtcgaattaaccgaaaaagacagtactaaagaa
attaaagagattaaaaaaattataaatggtgatggagctttcataatgcttggatatacc
ccaaatagcgaatttttacaagaaagtggtataaatctaaaaaaaggatttgtaataact
aataaagaatgtgaaactaatatcgaaggtatctacgcttgtggcgatattactggagga
attttgcaggtttctaaggcagtcggtgaaggagtttatgctttttcaagtgcttccaaa
tatttgcaaaaatttgataaataa

DBGET integrated database retrieval system