KEGG   Methanococcus voltae: Mvol_0687Help
Entry
Mvol_0687         CDS       T01251                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mvo  Methanococcus voltae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvol_0687
Enzymes [BR:mvo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mvol_0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(754971..755765)
Genome map
AA seq 264 aa AA seqDB search
MDIKLNDRIERYSSGKRVSSYSSKGSYVKYKSNSNNDIAFDATIKASAPFQKFRRENSNK
NLSLYIESEDMKYKVKKKNISTHIMFGVDASGSMGVLKRMEASKGAVVSLLMDAYQNRDK
VSMVAFRKDKAELVVPFTSSVELAEANLVGLKTGGRTPLYDAFTKAYETFEIEMRKNPNM
IPILVMISDFKPNVNINKNYFVEICEIVEKLLEKNIRTIFIDTEKKSFVKIGIGENIAKK
YGIDYYNIDNLTDDDILNTISSVN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttggatattaaattaaatgatagaatagaaagatattcaagcggtaaacgtgtaagtagt
tatagttctaaaggtagctatgtaaaatacaagtcaaattcaaataacgacatcgctttt
gatgctacaatcaaagcatcagcaccatttcaaaaattccgacgagaaaacagtaataaa
aatttatcgctatatattgaatcggaagatatgaaatataaggttaaaaagaaaaatatt
tctacccacataatgtttggagtggatgcaagtggctcaatgggagttttaaagcgtatg
gaagcttcaaaaggtgcagtagtttccttattgatggacgcttatcaaaacagagataaa
gtatcaatggtagcttttagaaaagataaagcagagcttgtagttccatttacttcatca
gtggaacttgcagaggctaacctcgtaggtttaaaaacaggcggtaggacaccactttac
gatgcgtttactaaggcttatgaaacatttgagatagaaatgcgtaaaaatccaaatatg
atacccatattagtgatgattagcgattttaaaccaaatgtaaatattaacaaaaattat
tttgttgaaatttgcgaaatcgttgaaaaattgcttgaaaaaaatattagaacaatattt
atagacactgaaaagaaatcctttgtaaaaattggtatcggtgaaaatattgctaagaaa
tatggtatagattattataatattgataatttaaccgatgatgatatattaaatacaata
tcttccgtaaattaa

DBGET integrated database retrieval system