KEGG   Methanococcus voltae: Mvol_0688Help
Entry
Mvol_0688         CDS       T01251                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Organism
mvo  Methanococcus voltae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(756026..757096)
Genome map
AA seq 356 aa AA seqDB search
MAKNFHFPFTAIEGQEEMKKALLLNAINPSIGGVLIRGEKGTAKSTTVRSLTDILPQIEV
MDSCLFNCDPKGNMCDECLSKNKPYKTVFKEMKVVTLPIGSTEDRVIGTIDIEKAIKEGI
KSLDKGILADANRNILYLDEVNLLDDHIVDILLDAAAMGWNTIEREGINIRHPSKFILVG
TMNPEEGELRPQILDRFGLMVNVDGLMDVKKRVNVIKKVEEFNLNPEIVLEEYSIEQNVL
MEQISNARKILPTVKIENDLLEFISQICIEMNIPTNRADITVARTAKTIAALNQRDYVVI
DDIKEACELALPHRMRRKPFDPPTLNNEKLEQFFDEFENENDNNDNDNNNEDDSKN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaatttccatttcccattcactgcaatagaaggacaagaagaaatgaagaaa
gcactacttttaaacgctataaatccctcaataggtggcgttttaataaggggtgaaaaa
gggactgcaaagtctacaacagttaggtctttaaccgatatattaccacaaatagaagtt
atggacagctgtctttttaactgtgaccctaaaggaaatatgtgcgatgaatgtttatca
aagaacaaaccctataaaacagtttttaaagaaatgaaggtcgttaccttacctataggt
agtactgaagatagagtaattggtacaatcgacatagaaaaagcgattaaggaaggcatc
aaatcacttgataaaggtattttagcagatgcaaatagaaatatattatatttagacgaa
gtaaacttattagatgaccatattgtagatattttactcgacgccgcagctatgggttgg
aatactatcgaaagagaaggtataaacattaggcacccatctaaatttatattggtgggt
actatgaaccctgaggagggggaattaagacctcaaatattggatagatttggattaatg
gttaacgtagatggattaatggacgttaagaagagagtaaatgtaattaaaaaggttgaa
gagttcaatttaaaccccgaaattgttttggaagaatattccattgaacaaaacgtatta
atggaacaaattagcaatgcaagaaagattttaccaacggttaaaattgaaaatgatttg
cttgagtttatatctcagatatgtatcgaaatgaatataccaactaatagggcagatatt
acagtagcgagaaccgcaaaaacaattgcagcactaaatcaacgtgattacgtcgttatt
gatgatataaaagaagcttgtgagcttgctttacctcacagaatgagaagaaaaccattc
gacccacctaccttaaacaatgaaaagttagagcaatttttcgatgaatttgaaaatgaa
aacgataataacgataatgacaataataatgaagatgattcaaaaaattag

DBGET integrated database retrieval system