KEGG   Methanococcus voltae: Mvol_0688Help
Entry
Mvol_0688         CDS       T01251                                 

Definition
(GenBank) Magnesium chelatase
Organism
mvo  Methanococcus voltae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM Sigma54_activat AAA_16 Mg_chelatase_C AAA_22
Motif
Other DBs
NCBI-ProteinID: ADI36347
JGI: Mvol_0688
UniProt: D7DT87
Position
complement(756026..757096)
Genome map
AA seq 356 aa AA seqDB search
MAKNFHFPFTAIEGQEEMKKALLLNAINPSIGGVLIRGEKGTAKSTTVRSLTDILPQIEV
MDSCLFNCDPKGNMCDECLSKNKPYKTVFKEMKVVTLPIGSTEDRVIGTIDIEKAIKEGI
KSLDKGILADANRNILYLDEVNLLDDHIVDILLDAAAMGWNTIEREGINIRHPSKFILVG
TMNPEEGELRPQILDRFGLMVNVDGLMDVKKRVNVIKKVEEFNLNPEIVLEEYSIEQNVL
MEQISNARKILPTVKIENDLLEFISQICIEMNIPTNRADITVARTAKTIAALNQRDYVVI
DDIKEACELALPHRMRRKPFDPPTLNNEKLEQFFDEFENENDNNDNDNNNEDDSKN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaatttccatttcccattcactgcaatagaaggacaagaagaaatgaagaaa
gcactacttttaaacgctataaatccctcaataggtggcgttttaataaggggtgaaaaa
gggactgcaaagtctacaacagttaggtctttaaccgatatattaccacaaatagaagtt
atggacagctgtctttttaactgtgaccctaaaggaaatatgtgcgatgaatgtttatca
aagaacaaaccctataaaacagtttttaaagaaatgaaggtcgttaccttacctataggt
agtactgaagatagagtaattggtacaatcgacatagaaaaagcgattaaggaaggcatc
aaatcacttgataaaggtattttagcagatgcaaatagaaatatattatatttagacgaa
gtaaacttattagatgaccatattgtagatattttactcgacgccgcagctatgggttgg
aatactatcgaaagagaaggtataaacattaggcacccatctaaatttatattggtgggt
actatgaaccctgaggagggggaattaagacctcaaatattggatagatttggattaatg
gttaacgtagatggattaatggacgttaagaagagagtaaatgtaattaaaaaggttgaa
gagttcaatttaaaccccgaaattgttttggaagaatattccattgaacaaaacgtatta
atggaacaaattagcaatgcaagaaagattttaccaacggttaaaattgaaaatgatttg
cttgagtttatatctcagatatgtatcgaaatgaatataccaactaatagggcagatatt
acagtagcgagaaccgcaaaaacaattgcagcactaaatcaacgtgattacgtcgttatt
gatgatataaaagaagcttgtgagcttgctttacctcacagaatgagaagaaaaccattc
gacccacctaccttaaacaatgaaaagttagagcaatttttcgatgaatttgaaaatgaa
aacgataataacgataatgacaataataatgaagatgattcaaaaaattag

DBGET integrated database retrieval system