KEGG   Methanococcus voltae: Mvol_0721Help
Entry
Mvol_0721         CDS       T01251                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mvo  Methanococcus voltae
Pathway
mvo00010  Glycolysis / Gluconeogenesis
mvo00620  Pyruvate metabolism
mvo00640  Propanoate metabolism
mvo00680  Methane metabolism
mvo00720  Carbon fixation pathways in prokaryotes
mvo01100  Metabolic pathways
mvo01110  Biosynthesis of secondary metabolites
mvo01120  Microbial metabolism in diverse environments
mvo01130  Biosynthesis of antibiotics
mvo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvol_0721
   00620 Pyruvate metabolism
    Mvol_0721
   00640 Propanoate metabolism
    Mvol_0721
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mvol_0721
   00680 Methane metabolism
    Mvol_0721
Enzymes [BR:mvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mvol_0721
Lipid biosynthesis proteins [BR:mvo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mvol_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADI36380
JGI: Mvol_0721
UniProt: D7DTC0
Position
complement(799229..800911)
Genome map
AA seq 560 aa AA seqDB search
MVSLLNEYVNKVDFESYEDFKENFEINVPENFNFAYDVVDRYAKEHPDKKALIWCNDEGV
EKIFTFSDMKKYSDKTANFFLNNGIKKGDVVMLTLKSRYEFWFCILALHKIGAIALPATH
MLTTRDIVYRAEEAKMKMVVCIDDESVLQYVNEAYDEVNDDLKFKRVSVGNKDVENWANF
RKEFEKTSETFVKPKECETENGDTMVGYFSSGTSGFPKLIKHDYLYPLGHILTSKFWQNV
QEDGLHYTVADTGWAKCLWGKLYGQWICGSAVFVYDYEKFDAKHMLNKASKHGVTTFCAP
PTVYRFLIKEDLSKYEFSTLKYAVTAGEPLNPEVYNKFYEFTGLKLMEGFGQTELVAVVA
NFPGMEPKPGSMGKVSPLYDIKLLNYAGEECDVGEEGEIVVMTDRENKPVGMFAGYHDEE
KTNSAWYGGVYHTGDTAWKDEDGYLWFVGRTDDIIKSSGYKIGPFEVESALMTHPAVLEC
AITGVPHPVRGQVVKATIVLAKDYTASDDLKKELQNHVKNTTAPYKYPRIVEFVEELPKT
ISGKIRRNCIRHKDKDLCNK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggtttcattattaaatgaatatgtaaacaaggtagattttgaatcatacgaagatttt
aaggaaaattttgagataaacgttccagaaaactttaattttgcatacgacgtagtagat
agatacgcaaaagaacatcctgacaaaaaagcattaatatggtgcaatgacgagggtgta
gaaaaaatatttacattcagcgatatgaaaaaatatagtgataaaacagcgaatttcttc
ttaaataatggtataaaaaagggcgatgtagtaatgctcaccttaaaaagccgttatgaa
ttctggttctgcatattggcactccataagataggtgcaatagcattgcctgctacacat
atgttaaccacaagagacatcgtatacagggctgaagaagctaaaatgaaaatggttgtt
tgtatagacgatgaaagcgttttgcaatatgtaaatgaagcttatgatgaagttaacgac
gatttaaaattcaaaagagtttcagttggaaataaagacgttgaaaattgggctaatttc
agaaaagaatttgaaaaaacttctgaaacttttgttaaaccaaaagaatgcgaaacagaa
aatggcgacactatggtaggatatttctcatcaggtacgtcaggatttcctaaattaata
aaacacgattacttatatccattaggtcatatactaacttctaagttctggcaaaatgta
caagaagacggtttgcactacacagtagcagacaccggttgggcaaaatgtttatggggt
aaactctatggtcaatggatatgtggttcagcagtatttgtttacgactacgaaaagttt
gatgctaaacatatgcttaataaagcttcaaaacacggcgtaacaacgttttgcgcacca
cctacagtatatagatttttgataaaagaagatttatcaaaatatgagttttcaactttg
aaatatgctgtgacagctggagaaccgttaaatcctgaagtatataacaaattttatgaa
ttcactggtttaaaactgatggaaggatttggacaaactgaattggttgcagtagtggcc
aatttcccaggaatggaaccaaaacctggttctatgggtaaagtatcaccattatacgat
ataaagttgttaaattatgcaggagaagagtgcgacgtcggagaagaaggggaaatcgtt
gtaatgaccgatagggaaaataaacctgtaggaatgtttgcaggataccacgacgaagaa
aaaacaaattcagcgtggtatggtggagtttatcatacaggcgatacagcttggaaagat
gaagatggatatttatggtttgtaggtagaaccgatgatataataaaaagttctggttat
aaaataggtcctttcgaagtagaaagtgctttaatgactcatccggcagtactggaatgt
gcaataaccggtgtacctcatccagttagaggccaggttgtaaaagctacaatagttctt
gcaaaggattatactgcttcagatgacttgaaaaaggaattacaaaatcacgttaaaaat
acgacagcaccgtacaaatatccaagaatagttgaatttgtggaagaattgccaaaaact
ataagtggaaaaatcaggagaaattgcataagacataaagataaggatttatgcaataaa
taa

DBGET integrated database retrieval system