KEGG   Methanococcus voltae: Mvol_0878Help
Entry
Mvol_0878         CDS       T01251                                 

Definition
4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mvo  Methanococcus voltae
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvol_0878
  Energy metabolism
   00680 Methane metabolism
    Mvol_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(995126..995617)
Genome map
AA seq 163 aa AA seqDB search
MPEHILSGIKSIVALNLRKDGKLQREIADYLEMDRSIVSHYLHGRYPSRKVIEVSEKIVK
LPMELSIPIISSLSDNKQLTKKLINSLYDIAIIYKSNACIGCGKCLECPYGAVNNTDNIG
ISIDHQACVLCGDCIDECPVSAIRFKSTGKLKFELISQDFDQP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacatatattgtcagggattaaatcgatagtagcactaaatttaaggaaagac
ggtaaattacaacgtgaaattgccgactatcttgaaatggaccgctcaatcgtttcccat
tatttgcacggtaggtatccctccagaaaagtaattgaagtttctgaaaagattgttaaa
ttaccaatggagttaagtatacccataataagttcattgagtgataataaacaacttact
aagaaattaataaattctttgtatgacattgcgataatctacaaatcaaatgcttgtata
ggttgtggaaagtgtttagagtgcccttatggtgctgtaaacaatactgacaacatcggt
atttctatagaccatcaagcgtgcgttttatgtggtgattgtattgatgagtgccctgtt
tcagcaatacgatttaaaagtactggaaaattaaaatttgaactgatttctcaggatttt
gaccagccataa

DBGET integrated database retrieval system