KEGG   Methanococcus voltae: Mvol_0890Help
Entry
Mvol_0890         CDS       T01251                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mvo  Methanococcus voltae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mvol_0890
   00052 Galactose metabolism
    Mvol_0890
   00500 Starch and sucrose metabolism
    Mvol_0890
   00520 Amino sugar and nucleotide sugar metabolism
    Mvol_0890
Enzymes [BR:mvo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mvol_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1005172..1006035)
Genome map
AA seq 287 aa AA seqDB search
MVKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLAEAGVSDVIIVTGKGKY
AIENHFDKNFELEERLKKDAKCDALKAISDINNLATIYYTRQGKQLGLGHAIGCGGEFVG
DEYSILMVGDTIYSQNVAKALIDAHEKYGCSVIALERVPMEDVSKYGVIEGGQIEEGVYN
IHDLVEKPPVSEAPSNLIITGAYLLSPKIFEHIKNTKPGRGNEIQLTDAMKTLLTEEKII
GIELNYKRYDIGDIKGWLEANVELGIENIPGFKEYLKSLCDEEINTK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaagcgataattccagcagcaggttttggtacaagattattaccaattaca
aaagcacaacccaaagagatgcttccggtgttgggtaaaccaataatccagtatgtaatc
gaagatttggcagaagcaggcgtatctgatgtaataatcgttactggaaagggcaaatat
gcaatagaaaaccattttgataagaattttgaacttgaagaacgattgaagaaagatgca
aaatgtgatgctttaaaggcaatcagtgatattaataatcttgcaacgatttactataca
agacaaggcaagcaacttggattggggcacgcaataggttgtgggggcgaatttgtaggt
gatgagtattctattttaatggtgggcgatacaatatactcacaaaatgttgcaaaagca
ctaatcgatgcacacgaaaaatatggttgttcagtaatagcactcgaaagagttcctatg
gaagacgtttcaaaatatggtgtaattgagggcgggcaaatcgaagaaggggtttataac
attcacgatttagtggaaaaaccaccagtttcagaagctccatcaaatttaatcattaca
ggagcttatttgttatctccaaagatatttgaacacattaaaaatacaaaaccaggacgt
ggaaatgaaatccaattaacagacgcaatgaaaaccttgttaaccgaagaaaaaattatc
ggaatcgaattaaattacaagagatacgatattggggatataaaaggatggttagaggca
aacgttgagttaggaattgaaaacatacctggatttaaagaatatttaaaatcgttatgt
gatgaagaaattaatacaaaatag

DBGET integrated database retrieval system