KEGG   Methanococcus voltae: Mvol_0930Help
Entry
Mvol_0930         CDS       T01251                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mvo  Methanococcus voltae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvol_0930
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mvol_0930
   00640 Propanoate metabolism
    Mvol_0930
   00660 C5-Branched dibasic acid metabolism
    Mvol_0930
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mvol_0930
Enzymes [BR:mvo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mvol_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1057311..1058402)
Genome map
AA seq 363 aa AA seqDB search
MKLHEYEAKAIFKSYGIPVPESEITDKKVENIDKPVVVKAQVLVGGRGKAGGILFANNTQ
EANEKIEELLNKEIKGEKVEKVLLEDMINIEKEYYVGIVIDRNNKQAVVMFSTEGGVDIE
QVAEKTPEKIIKYYVDFDKEFQPYMARNMLIKAGIPSPEISKIATIISKLYKAFEDMDGS
LIEINPLVITKEANVIAADAVFNLDDDAYYKHDYKQFEEFSKQDKSEFAYVDLDGDIAVI
GNGAGLTLASMDIVKNSGGEPSCFLDVGGGSNSETVQKALRKALSKDGVKGVFINILGGI
TRCDEVSKGIVEVYKDYPNVKFAVRLMGTNEDEGRRILNENGISFETTMDNAAKKLMEII
QSN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatatgaagcaaaggcaatatttaaatcatacggaattccagttcct
gaaagcgaaataaccgacaaaaaagtggaaaatatcgataaacctgtagttgttaaagca
caggtacttgtaggtggcaggggaaaagcgggaggaattttatttgcaaataacactcaa
gaagcaaacgaaaaaatcgaagaattgttgaataaggaaattaaaggcgaaaaagtagaa
aaagtacttcttgaagatatgataaacattgaaaaagagtattatgtgggtattgtaatc
gataggaacaataaacaagctgttgtaatgttttcaactgaaggcggtgtcgatatcgaa
caagtggctgaaaaaacgcctgaaaagataataaaatactatgtagactttgataaagaa
ttccaaccttatatggcaagaaatatgttaataaaagcgggaattccctcacctgaaatc
tcaaaaattgccacaattatctcaaaactttataaagcatttgaagatatggatggttct
ttaattgaaataaatcctctggtaattacaaaagaagcaaatgtaattgcagcagatgca
gtatttaatttagacgacgatgcgtactataaacacgattataaacaatttgaagagttc
agtaaacaagacaaatcagaatttgcatacgttgatttagatggggacattgcagtaata
gggaacggtgcaggtttaacattagcgtcaatggacattgttaaaaattcaggcggtgaa
ccatcttgctttttagatgtgggtggcggttcaaacagtgaaactgttcaaaaggcatta
agaaaagctttatcaaaagatggcgttaaaggagtatttataaacattttgggcggtatt
acccgatgtgatgaagtttcaaaaggtattgtggaagtttacaaggattatccaaatgtt
aaatttgccgttagattaatgggtacaaatgaagacgaaggtaggagaatattaaatgaa
aatggtatttcttttgaaactacaatggataacgctgctaaaaagttaatggaaattatt
caatctaattaa

DBGET integrated database retrieval system