KEGG   Methanococcus voltae: Mvol_0948Help
Entry
Mvol_0948         CDS       T01251                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mvo  Methanococcus voltae
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mvo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mvo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1077151..1078299
Genome map
AA seq 382 aa AA seqDB search
MKKIKAIVVDDSAFMRKVVEDILNTDPEIEVVGTAKDGKEAVELTKSLKPDVITMDVEMP
IMNGLEATKIIMQTCPAPILMLSAVTREGSETTLKALENGAVDFIQKPSGSISLDIREIS
EKITKKVKEVSKSTVRPIKLTERFQTSENSKKETNSPNLNVENKKTENTVNQNAVRNPKI
DETLSKIGIMIGSSTGGPPVVSEIISRLSTDMPPIFIVQHMPAGFTRVFAERIDRISKLK
VVEASNGTLVKPNHVYIAPGDTQMLLKKRGNNIYIEIDPNMPKLHGTKPTVDITAEYVAN
IYGNNSIGIILTGIGKDGAIGMRNIKEKGGFTIGQNKESCIVYGMPKTAYELNALNDVLP
PSQIPKKIEKCVEKYTQKLGSR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataaaggctatagttgtagatgactcagcattcatgcgaaaagttgtagaa
gatatattaaacacagaccctgaaattgaagtcgtaggaactgcaaaagatggaaaagaa
gctgttgaattaacaaaaagtttaaaaccagatgtcataacaatggatgttgaaatgccc
attatgaatggacttgaagcaactaaaattattatgcaaacttgccctgcacctattctt
atgctttctgcagtaactcgagaaggttcggaaactacgttaaaagcccttgaaaatgga
gcagttgactttatacaaaaaccttcaggttcaatttcgttagacattcgagaaatatct
gaaaaaattacaaaaaaggttaaagaagtttccaaatctacagtacgacctataaaatta
actgaaagatttcaaacatctgaaaattcaaaaaaagaaactaatagtccaaatttgaat
gttgaaaataaaaaaaccgaaaacacggtaaaccaaaatgccgtaaggaatccaaaaata
gatgaaacactttcaaaaatcggtattatgataggttcttctacaggtggacccccagta
gtttcagaaataatttcaagattgtcaacagatatgcccccaatatttattgtacagcac
atgcctgcaggatttacgagagtttttgcggaaagaattgataggatatcaaaattaaaa
gttgtagaagcttcaaacggtacattggttaaacctaatcatgtatacattgccccagga
gatacacaaatgttattgaaaaaacggggaaataacatatatattgaaatagacccaaat
atgcccaaacttcacggtactaaacctacagtagatattaccgctgaatacgttgcaaat
atttatggaaataattctattggaattattttaacaggtattggaaaagatggtgcaata
ggaatgcggaacattaaagaaaaaggtggattcactattggtcaaaataaagagagctgc
attgtttatgggatgcccaaaactgcttacgagctaaatgcgttaaatgatgttttacca
ccaagccaaatacctaaaaaaatagaaaaatgcgttgaaaaatatactcaaaaattaggg
agtaggtaa

DBGET integrated database retrieval system