KEGG   Methanococcus voltae: Mvol_0994Help
Entry
Mvol_0994         CDS       T01251                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mvo  Methanococcus voltae
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mvol_0994
Enzymes [BR:mvo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mvol_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1131228..1131779
Genome map
AA seq 183 aa AA seqDB search
MDHILAEFVDVCKKLYERKYVVGSGGNVSIKVGNLVFITPTGHILGFMEKEKICIVDMDG
DILKGKPTSELNMHLKIYKNRKDVNAIVHTHCMYCTAFSNIDKEIKLITPEGQLFIRKID
YIDYYPCGSMELAEAVSGSEESAIVLKNHGLVTVGETIFEAYLKTEVVEELAQMNYIIHN
MIK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaccatatattagctgaatttgtcgacgtgtgcaaaaaactttacgaaagaaagtat
gttgttggctcaggcggtaatgtaagtattaaagttggaaacttagtttttataacccct
acaggtcatatattaggttttatggaaaaagaaaagatatgtattgttgatatggatggg
gatatattaaaaggaaaacctacttctgaattaaatatgcacttaaaaatttacaaaaat
agaaaagacgtaaatgcgattgtgcatactcattgtatgtattgtacagctttttcaaat
atcgataaagaaataaagcttataacgccagaaggacagttatttattcgtaaaatcgat
tatattgattattacccttgtggcagtatggaattagctgaagctgtttcaggtagcgaa
gaaagtgccattgttttaaaaaatcatggtttagtcacagttggggaaaccatttttgaa
gcatacttaaaaactgaagttgtagaagaacttgcccagatgaattacattatccacaat
atgataaaataa

DBGET integrated database retrieval system