KEGG   Methanococcus voltae: Mvol_1074Help
Entry
Mvol_1074         CDS       T01251                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mvo  Methanococcus voltae
Pathway
mvo00010  Glycolysis / Gluconeogenesis
mvo00020  Citrate cycle (TCA cycle)
mvo00620  Pyruvate metabolism
mvo00633  Nitrotoluene degradation
mvo00640  Propanoate metabolism
mvo00650  Butanoate metabolism
mvo00680  Methane metabolism
mvo00720  Carbon fixation pathways in prokaryotes
mvo01100  Metabolic pathways
mvo01120  Microbial metabolism in diverse environments
mvo01130  Biosynthesis of antibiotics
mvo01200  Carbon metabolism
Module
mvo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mvo_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvol_1074
   00020 Citrate cycle (TCA cycle)
    Mvol_1074
   00620 Pyruvate metabolism
    Mvol_1074
   00640 Propanoate metabolism
    Mvol_1074
   00650 Butanoate metabolism
    Mvol_1074
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mvol_1074
   00680 Methane metabolism
    Mvol_1074
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mvol_1074
Enzymes [BR:mvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mvol_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C SPICE DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: ADI36731
JGI: Mvol_1074
UniProt: D7DUC1
Position
complement(1215861..1216754)
Genome map
AA seq 297 aa AA seqDB search
MARQFPREELFAPGHRGCAGCGAAIVARLALKAAGKNTIVANATGCLEVMTTPYPETAWR
VPWMHVAFENAAAVASGIEAAVKSLKRKRGLYEGEKVNVIAFGGDGGTADIGFQALSGAM
ERGHDMVYIMYDNEAYMNTGVQRSGSTPFMASTTTSPAGSVIRGENRPKKNMPMIMAAHG
IPYVATASISYPEDFMNKVKKACEIDGPAFIQILQPCTTGWGYPASKTVELGRLAVKAGI
WPLYEIENGEYRVTYKPSKRISIEEYLKTQKRYRHLTEEDVEEMQQLIDHKCQEMGI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacaattcccaagagaagaattatttgctcccggacacagaggttgtgcaggt
tgtggagcagcaattgttgcaagattagctttaaaagcagcaggtaaaaacaccatcgta
gcaaacgctaccggatgtctcgaagttatgacaactccatacccagaaacagcttggaga
gtgccttggatgcacgttgcatttgaaaacgcagcagcagttgcaagtggtatcgaagca
gcagttaaatccttaaaaagaaaaagaggactttacgaaggcgaaaaagtaaatgtaatc
gctttcggcggtgatggtggtacagcagatatcggtttccaagcattaagtggtgcaatg
gaaagaggacacgatatggtatatattatgtacgataacgaagcatatatgaatacaggg
gttcaaagaagtggttcaactccatttatggcttcaacaactacatcaccagcaggtagt
gtaattaggggagaaaatagacctaagaagaatatgcctatgattatggcagctcacggt
attccctatgtggctacagcttcgattagctacccagaagactttatgaacaaagttaaa
aaagcttgtgaaattgatgggccagcatttattcaaattttacagccttgtacaacaggt
tggggttatccagcatctaaaacagttgaattaggtagattggcagttaaagcaggaatt
tggccactttacgaaattgaaaatggtgagtatagggtaacatacaaaccttcaaaaaga
atttcaattgaagagtacttaaaaactcaaaaaagatacaggcatttaaccgaagaagac
gttgaagaaatgcaacaattaatcgaccacaaatgtcaagagatgggaatttaa

DBGET integrated database retrieval system