KEGG   Methanococcus voltae: Mvol_1140Help
Entry
Mvol_1140         CDS       T01251                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mvo  Methanococcus voltae
Brite
Enzymes [BR:mvo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mvol_1140
Transfer RNA biogenesis [BR:mvo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mvol_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1283541..1285202
Genome map
AA seq 553 aa AA seqDB search
MTSELSKIKKTYEYKKFIRCLIDELLINKEKIDELDAKRKKQRVEDIKAKCLRKFNLNIG
FPPNSDVLALATDEEKKKLSLILRKKPIRTLSGVAVVAVMTSPEPCPHGKCAFCPGGKES
VFGDVPQSYTGKEPATMRGIMYNFDPYVQTSERLKQLENVGHPTDKVELIIMGGTFPARD
TSYQENFIKGCLDAMNGVISETLEEAQKINETASHRCVALTIETRPDYCKEEHVNEMLKL
GATRVELGIQSTYDEILDFVKRGHSVSESIKATSRLKNSGLKVSYHIIPGLPHTTEEMDK
ENIRRVFNNPEFKPDLIKFYPCLVIEGTELYDLWKKGEYKPITDEEAVELITYGKSIMPK
WIRTSRIQRDIPATVIDEGVKKSNLGELVYNNLEKKGIKCKCIRCREVGHVCYKKGIKPD
NSSIKLLIEEYEASGGKEFFITYEDIKNDLLIGYLRLRIPDMNSVFRPEIDENTALIRQV
HVCGQQQELGSKIEDTKNWQHKGYGKLMLEEAEKLAKSLGKSKILITSGIGVREYYKKQG
YDRIGPYMGKKLN
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgaactttcaaaaattaaaaaaacatacgaatacaaaaaatttataagatgt
ttaattgatgaattattgattaataaagaaaaaatcgacgaattagatgcaaaacgtaaa
aaacaaagagtagaagatattaaagcaaaatgtcttcggaaatttaatttaaatatagga
tttcccccaaattccgacgtacttgctcttgctacagatgaagaaaaaaagaaactatcg
ctaatcttacgaaaaaaacctattagaacactttccggtgttgcggttgttgctgtaatg
acttcacctgaaccttgcccacacggtaaatgtgctttttgccccggaggtaaggaaagc
gtattcggagatgttccccaaagttatacgggaaaagaacctgctactatgcgaggaatt
atgtataattttgacccatatgtacaaacgtctgaaagattaaaacagcttgaaaatgta
ggtcatcccacagataaagtggaactcattattatgggcggtacattcccagctcgagat
acttcataccaagaaaactttataaaaggctgtttagacgctatgaatggagtaatctct
gaaacacttgaagaagctcaaaaaataaatgaaactgcttcacataggtgtgttgctctt
accattgaaacacgtcctgattactgtaaagaagaacacgttaatgaaatgttaaaatta
ggtgctacccgtgttgaattaggtattcaaagtacgtatgatgagatattagactttgta
aaaagaggtcattcggtttctgaatcaattaaagctacatcacgtcttaaaaatagtggt
ttaaaagtatcttaccacatcataccaggtttaccacatacgactgaagagatggataaa
gaaaatattaggcgagtattcaataatccagagtttaaacctgatttaataaaattctat
ccttgtttggtaattgaaggtactgaattatatgatttatggaaaaaaggagaatataaa
ccgattactgacgaagaagcggttgaattaatcacctatggtaaatcgattatgccgaag
tggattaggacatcacgtattcaaagagatatacctgcaacagttattgatgagggcgtt
aaaaagagtaatctcggagaattggtatataataacctcgaaaagaaaggtataaagtgt
aaatgtataagatgtagagaagtaggtcatgtttgctacaaaaaaggtataaaaccagat
aattcaagtataaaattacttattgaagaatatgaagcaagcgggggaaaagaattcttt
ataacctatgaagatattaaaaacgatttattaatcggatacttaagacttagaattcca
gatatgaatagtgtttttagacccgaaatagatgaaaataccgctttaataaggcaagtg
cacgtttgtgggcagcaacaagaattaggttctaaaatagaagatactaaaaattggcaa
cataagggttatggcaaattaatgcttgaagaagctgaaaaacttgcaaaaagccttgga
aaatctaaaatattaataacaagtggtattggagtccgagaatattataaaaaacaaggt
tatgaccgcataggtccatatatgggtaaaaaactaaattaa

DBGET integrated database retrieval system