KEGG   Methanococcus voltae: Mvol_1197Help
Entry
Mvol_1197         CDS       T01251                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mvo  Methanococcus voltae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvol_1197
   01230 Biosynthesis of amino acids
    Mvol_1197
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvol_1197
   00030 Pentose phosphate pathway
    Mvol_1197
   00051 Fructose and mannose metabolism
    Mvol_1197
  Energy metabolism
   00680 Methane metabolism
    Mvol_1197
Enzymes [BR:mvo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mvol_1197
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mvol_1197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1350472..1351620)
Genome map
AA seq 382 aa AA seqDB search
MEEKITVSVIKADVGGLCGHTLAPIELLDAVEYVVENAVDETLIDYYVTNCGDDIDIVMT
HNKGTDNDEVHKLAWDALTDATDVAKELKLYGAGQDLLSDSFSGNVKGLGPGCAEMEFVE
RRSEPLVVFCCDKTDPAAFNLPFYKMFSSPFNTPGLVFDPSMTEGFKYEVMDIIDHKRVL
MSTPVETYSLLALIGNLERYAIKRVYRGRDNEIAAVASSEKLNMMAGEYVGKDDPVAIVR
AQSGFPAVGEILEAFANPHLVSGWMRGCHWGPMMPVGEEDAMPSRFDGPARIMALGFQLS
KGRLVGPNDLFADVAFDKARDKALEMAEMMRSMGPFQPHRLPESMMEYTSVPKVLKTLES
RFEEIPENNCKLEKTTDRGDLE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaataaccgtaagtgttatcaaagcagatgtgggcggtttatgcggtcac
acattagctcctattgaattattagacgctgttgagtacgtagttgaaaacgcagttgac
gagacattaatcgactactacgttacaaactgtggtgatgacatcgatattgttatgaca
cacaacaaaggtactgacaacgacgaagtgcacaaattagcttgggatgcattaacagac
gcaacagatgttgcaaaagaattgaaattgtacggtgcaggtcaagatttattgtctgac
tcattttcaggaaacgttaaaggtttaggtccaggatgtgcagaaatggaattcgtagaa
agaagaagcgaaccattagttgtattttgctgtgataaaacagacccggcagcatttaac
ttgccattttacaaaatgttcagtagcccattcaacactccaggtttagtatttgaccca
tcaatgacagaaggatttaaatacgaagtaatggacattatcgaccacaaaagagtttta
atgagcacaccagttgaaacatactcattattagctttaatcggaaacttagaaagatac
gcaattaaaagagtttacagaggacgcgacaacgaaatcgcagctgttgcaagttcagaa
aaattgaacatgatggcaggagaatacgttggtaaagatgaccctgtagctattgtaaga
gctcaaagtggtttcccggcagttggggaaattttagaagctttcgctaacccacactta
gtatcaggatggatgagaggatgccactggggtccaatgatgccagtaggggaagaagat
gctatgccatcaagatttgacggtccagcaagaattatggcattaggcttccagttatca
aaaggtagattggtaggtccaaatgacttattcgcagatgtagcattcgataaagcaaga
gataaggctttggaaatggctgaaatgatgagaagtatgggtcctttccaaccacacaga
ttacctgaatcaatgatggaatacacctcagtaccaaaagttttaaaaactttagaatca
agattcgaagaaatccctgaaaacaactgtaagttagaaaaaactactgataggggagat
ttggaataa

DBGET integrated database retrieval system