KEGG   Methanococcus voltae: Mvol_1211Help
Entry
Mvol_1211         CDS       T01251                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mvo  Methanococcus voltae
Pathway
mvo00010  Glycolysis / Gluconeogenesis
mvo01100  Metabolic pathways
mvo01110  Biosynthesis of secondary metabolites
mvo01120  Microbial metabolism in diverse environments
mvo01130  Biosynthesis of antibiotics
mvo01200  Carbon metabolism
mvo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvol_1211
Enzymes [BR:mvo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mvol_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C Sacchrp_dh_NADP TrkA_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ADI36868
JGI: Mvol_1211
UniProt: D7DUQ8
Position
1362137..1363195
Genome map
AA seq 352 aa AA seqDB search
MKIGHKKKNGDVMTAKILINGYGSIGKRVADAVACQKDMEVIGVTKTKPDFEAKMALEKG
YKLYAAVPERAHLFEEAGLEISGTIDDVIQDADLVVDGAPKKIGKQNLENLYKKNNVKAI
IQGGEKANDAEDSFNSLWSYDRCYGKDAIRLVSCNTTGLCRSLYAIDSITDVLKARVVLI
RRAVDPNDSKKGPVNAIIPSTDVPSHHGPDVESVIKKFKGKIISSAVIVPTTLMHMHSLM
VETTGATKDDIVDAIAKTPRIFTVKASEGLDSTAALIEMSRDMGRLRYDLNEIPVWEESI
NVIDNEIFMMQAVHQESDVIPENVDCIRAMLQMEEDNIKSIEMTNKAMGLLK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggacataaaaagaaaaatggtgatgtaatgacagcaaaaatattaataaat
gggtatgggtcgattggtaaaagagtagctgatgcagtagcttgccaaaaagatatggaa
gtaattggtgttacaaaaacaaaacctgattttgaagcaaaaatggctttagagaagggt
tataaattatatgctgcagtgcctgaaagagctcacctatttgaagaagcaggtttggaa
atatccggaacaattgatgatgtgattcaagatgctgatttagtagtagatggagcccct
aaaaagataggaaaacaaaatcttgaaaatctttacaaaaagaataatgtaaaagccatt
attcagggtggagaaaaagcaaacgatgcagaagactcttttaactcattgtggagctac
gatagatgttatggcaaagatgctattagattagtttcatgtaatacaacaggattatgc
aggtcattatatgccatagattccattacagacgttttaaaagcaagagttgtattaata
agaagagcggtagaccctaacgactctaaaaaaggtcctgttaacgcaattataccatca
acagatgtaccttcacaccacggcccagatgtagaatcagtaatcaaaaaattcaaagga
aaaattatttcatcagctgttatagtacctacaacattaatgcacatgcactcattaatg
gttgaaactacaggagctacaaaagacgatatagtagatgcaattgctaaaacgccaaga
attttcaccgtgaaagcttcagaaggtttagattcaacagcagctttaattgaaatgtca
agagatatgggaagattgagatacgatttaaacgaaattcctgtttgggaagaaagtata
aacgtaattgacaatgaaatctttatgatgcaagcagtacaccaagaaagtgatgtgatt
cctgaaaacgtagattgtataagggctatgttgcaaatggaagaagataacattaaatca
attgaaatgacaaataaagcaatgggtttattaaaataa

DBGET integrated database retrieval system