KEGG   Methanococcus voltae: Mvol_1274Help
Entry
Mvol_1274         CDS       T01251                                 

Definition
rRNA pseudouridine synthase
Orthology
K11131  
H/ACA ribonucleoprotein complex subunit 4 [EC:5.4.99.-]
Organism
mvo  Methanococcus voltae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1427328..1428338)
Genome map
AA seq 336 aa AA seqDB search
MSMERELLIKEESKTNYEFGTNPYNRDIKSLLETGIVIINKPSGPTSHEVSAWVRDILKV
SKAGHGGTLDPKVTGALPIALGNSTKCVPYWHIPPKEYVCIMRLHRDMKESKIGEKEILE
LFDNFIGKMYQRPPLKASVARKLRVRKIYELKLIEINEEINSVLFWVRCQSGTYLRKLVD
DFGEALGVSAHMQELRRVKSGPFFEEEAIYLQDLVDEYFYWKETGNEEYIREIIKPVEYG
LQHLQKVIIKDSAVNAICHGANLYANGISKIEKGIGPEEIVLVETLKGEAVAIGKTLANT
KKILKSDEELVIDIERVIMDKNIYPKMWKSSKKKKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagtatggaacgagaattattgattaaagaagaatcaaaaacaaattatgaatttgga
actaatccttacaatagggatataaagtctttattggaaacagggattgtaataataaac
aaaccttctggtccaacatctcatgaagtttctgcctgggtaagggatattttgaaagtt
tcaaaagctggacatggtggtactcttgacccaaaagtgaccggtgcattacctatagca
ctcggaaactcaacaaaatgtgtaccttattggcatattcctcctaaagaatatgtttgt
attatgagattacaccgagatatgaaggagtcaaaaatcggtgaaaaggaaattttggaa
cttttcgataatttcattggaaagatgtatcaaagacctcctttaaaggcttctgtagca
agaaagttaagagtaagaaaaatttatgaattgaaacttatagaaataaatgaagaaata
aattctgtactcttttgggtgcgatgtcaatcaggaacatacctaaggaaattagttgat
gattttggtgaagctttaggtgtttctgcacatatgcaagaattgagaagggttaaaagt
ggtccattttttgaggaggaagcaatttatttgcaagaccttgtagatgaatatttctat
tggaaagagactggaaacgaggagtatattcgtgaaattataaaacctgttgaatacggt
ttgcaacacttacaaaaggttataattaaagatagtgcggtaaatgcaatatgtcatggg
gcaaatctatatgccaatggtatctctaaaattgaaaaaggaatcggacctgaagaaatc
gttctggttgaaacattaaaaggtgaagctgtagctattggtaaaactcttgcaaacacc
aaaaagattttaaaatctgacgaagagctggttattgatattgaaagagtaataatggat
aaaaacatatatcctaaaatgtggaaatcatctaaaaagaagaaattttaa

DBGET integrated database retrieval system