KEGG   Methanococcus voltae: Mvol_1341Help
Entry
Mvol_1341         CDS       T01251                                 

Definition
Fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mvo  Methanococcus voltae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mvol_1341
   01230 Biosynthesis of amino acids
    Mvol_1341
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mvol_1341
   00030 Pentose phosphate pathway
    Mvol_1341
   00051 Fructose and mannose metabolism
    Mvol_1341
  Energy metabolism
   00680 Methane metabolism
    Mvol_1341
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mvol_1341
Enzymes [BR:mvo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mvol_1341
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mvol_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1500602..1501600
Genome map
AA seq 332 aa AA seqDB search
MTNFDSKEPIKLTHKIDIPLDVWEENISEYIENYNAITKGTGKLFIFAGDQKIEHLNNDF
KGEGISIEDSNPEHLFKIAKYGKIGAFATQFGLLCRYGRDYPSIDYIVKLNSKTNLVESC
QKDPLSTLLIDISDVIEFKKRTGLNIRGVGYTLYLGSEFESEMLSKAGRIIHEAHKNGLI
AVIWIYPRGKAVRNEKEPKIIAGATGVGACIGADFVKVNYPQSKEPEIDFKDAIASAGRT
KVICAGGSSKKPEKFLKILSEQINISGASGCATGRNIHQKSLLDAVALTYAINEIVYNNN
TIDDALEFLKPELKEKIRDEILLKQYESEKIK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atcaccaatttcgattcaaaagaacctataaaacttacccataaaatagatatcccatta
gacgtttgggaagaaaatatatcagaatacattgaaaattataatgcaattaccaaagga
actggtaaattatttatatttgccggagaccaaaaaatagaacacctaaataatgatttt
aaaggtgaaggaatatctattgaagactccaatccagaacatctgtttaaaattgctaaa
tacggaaaaataggtgcttttgctactcagtttggattattatgtagatatggtcgagac
tatccaagtatagattatatcgtaaaattaaattcaaaaactaatttagttgaaagttgc
caaaaagacccattaagcactttgttgattgatatttcagacgtaatagaattcaaaaaa
agaacgggtctaaatataaggggtgtaggatatacactatatttaggtagtgaattcgaa
agtgaaatgttatccaaagcaggtcgaataatccacgaagcacataaaaatggattaata
gcagttatttggatatatccacgaggaaaagctgttcgaaatgaaaaagaacccaaaata
attgctggtgccacaggggtaggagcctgcataggtgcagatttcgtaaaagttaattat
ccacagtctaaagagccagaaatagattttaaagatgcaatagcttctgcaggtagaacc
aaagtcatatgtgccgggggttccagtaaaaagccagaaaagtttttaaaaattctttct
gaacaaataaacattagtggagcttcaggttgtgcaacggggcgaaatattcatcaaaaa
tcattgttggatgcagtagcattaacctatgctattaatgaaatagtatacaataataat
accatagatgacgcattagagtttttaaaacctgaattaaaagaaaaaataagggatgaa
atacttttaaaacaatatgaatctgaaaaaataaaataa

DBGET integrated database retrieval system