KEGG   Methanococcus voltae: Mvol_1661Help
Entry
Mvol_1661         CDS       T01251                                 

Definition
Uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mvo  Methanococcus voltae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mvol_1661
Enzymes [BR:mvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mvol_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1863799..1864527
Genome map
AA seq 242 aa AA seqDB search
MKVLITRPKQKAKNFSDMLIENGFEPLILPTLELSFKKVDVSLDNYDWIVFTSPRGIEGL
FKNLTEIQKSQIKDKKIGVIGIETAKEFKKIFNFDPDLVPNSYTAENLLEALKKVVKPGE
KILIPTTPATRDVLVKNLNADLLFVYSSEEPKDISENLDNLKELLKNTGSDNLILTFTSG
LTAKNFFKHVDDELMNLFKKCKVVSIGPITKENVDKFGFDSLMPEKTYTIDGMMELIKNL
KN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattaattacacgaccaaaacaaaaagccaaaaatttttctgatatgttgata
gaaaatggctttgaacctttaatattgcctactttagagttatcttttaaaaaagtagat
gtatcactcgataattacgattggattgtatttacgagtccgaggggtatagaaggatta
tttaaaaatttaacagaaattcaaaaaagtcaaataaaagataaaaaaattggagtaatt
ggcattgaaacagctaaagaattcaaaaaaatctttaattttgacccagatttagtacca
aacagttatactgcggaaaatcttttggaagcccttaaaaaagttgtaaaacctggcgaa
aaaatattaattccgactacaccagctacaagagacgttttagttaaaaatttaaacgca
gatttgttatttgtttatagttcggaagaaccaaaagatatatctgaaaatttagataat
ttaaaagaacttttgaaaaatacaggttctgacaatttaatactcacatttacaagtggg
ttgaccgcaaagaatttttttaagcacgttgatgatgaacttatgaatttgtttaaaaag
tgtaaagtcgtttcaattggacccattacaaaagaaaatgttgataaatttggttttgac
tcattaatgcctgaaaaaacatatactattgacggaatgatggaattaataaaaaattta
aagaattaa

DBGET integrated database retrieval system