KEGG   Methanococcus voltae: Mvol_1718Help
Entry
Mvol_1718         CDS       T01251                                 

Definition
AMP phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mvo  Methanococcus voltae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mvol_1718
Enzymes [BR:mvo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mvol_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1927351..1929162)
Genome map
AA seq 603 aa AA seqDB search
MILKVKYIDLDIEKNSVVINEEDLKKSGYKVGDRLFLEVQGISLVVIIHSTNSIIKPGEV
GITKHISLKLDEGHDIELKQAIIPKSIKIIKKKLNGEILTTAEINTLISELKISRLSNTE
VSSFVAGSYINDMNMNEIVDMTKSMASTGDLLDWGRDTIVDVHSIGGIAGNKYALLVVPI
VAAAGVKIPKTSSRAITSGAGTADVLEVITNVTLTKNEIMDLIRDTNGCLIWAGGMSLAP
VDDMFINVESRLSINPKCLMLSSVMSKKVAMGIKCLVIDIPIGESAKVKTEAEARKLASS
FIELGELLKIKVECIITYGGQPLGRAIGPALEMKEALEALENPNDAPESLIEKSLSIAGI
LLEISGASMKGEGMDVAKEILYSGKALDKFREIVYKQYENKLKIISAKNKGGVNLSYDEN
YNVSENLFDNLNLNLNSEIDSEINSDENLENNESNITDGKEKDKDNKNNKDKKSKSKSKD
KGNNKKILKKDIEKIYLEKLNNLKSEDIKTGQYSYDIVSPTRGYITKVSNKGLIDVVKEA
GAPFDKKAGIMLNVKIGNNVKKGDVLYTIYSNSEEMLNNAIKLARRIYPVNVEGMIIKKV
SKF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgattctaaaagtaaaatatattgatttagacatcgaaaaaaactctgttgtaataaat
gaagaagatttaaagaaaagtggctataaagtaggagataggctatttttggaagtacaa
ggtatttctttagttgttataatacattctacaaattccatcataaaacccggagaagtt
ggaataacgaaacacatttctttaaaattagatgaagggcacgatatagaattaaaacag
gccattataccaaaatcaataaaaattattaaaaagaagcttaacggggaaattcttact
actgctgaaataaatacacttatttcagaattaaaaatcagtaggctctcaaatacggaa
gtatcctcttttgtagctggtagctatatcaatgatatgaatatgaacgaaattgtggat
atgactaaaagtatggcttcaaccggtgatttacttgattggggtagggatacaattgta
gacgttcacagtatcggaggtattgcaggtaataaatacgctttgcttgttgtccccatt
gtagccgctgccggtgtaaaaatacctaaaacttcatctcgtgccattacaagcggtgca
ggtactgcagatgttcttgaagtgattacaaacgtcacgttaactaaaaatgagataatg
gacttaattagagatactaacggttgcttaatttgggctggtggtatgagcttagcacct
gttgacgatatgtttataaatgtggaaagtaggctatcaataaaccccaaatgtttaatg
ttatcgagcgtaatgtccaaaaaggtagctatgggtattaaatgtttagtaatcgatata
cccataggagaaagtgctaaagttaaaacagaagctgaagcaaggaaattagcaagtagc
tttatagaacttggagaattgttaaaaataaaagtcgaatgtattattacttacggtggt
cagccattgggtagagcaattggtccagcgttagaaatgaaagaagcgttagaagctctt
gaaaatcctaatgatgcaccagaaagtttaatcgaaaaatcattatctattgcaggcata
cttttagaaataagcggggcttccatgaaaggggaaggtatggatgtagcaaaagaaata
ttgtattctggcaaagctcttgataaatttagagaaatagtctataaacagtatgaaaat
aaattaaaaataatatctgcaaaaaataagggaggtgtaaatttaagttatgatgaaaac
tataacgtaagtgaaaatttattcgataatttaaacttaaatttaaattctgaaattgat
tctgaaatcaattcggatgaaaatttagaaaataatgaatctaacattacagacggaaaa
gaaaaggataaagataataaaaataataaagataaaaaaagtaagtccaaaagtaaagat
aaaggtaataataaaaagatattgaaaaaagatattgaaaaaatatatttggaaaaatta
aataatttaaaatctgaagacataaaaacaggtcaatatagctacgatatagtttcacct
acacgtggatacattactaaagtatcaaacaaaggattaattgacgttgtaaaagaagct
ggcgctccttttgacaaaaaagcagggattatgttaaacgttaaaattggaaacaatgta
aaaaaaggcgacgtactgtataccatatactcaaactctgaagaaatgcttaacaatgcg
attaaattggcaagacgtatttatcccgttaatgtagaaggtatgattatcaaaaaagta
agtaaattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system