KEGG   Mannheimia varigena USDA-ARS-USMARC-1261: X781_6960Help
Entry
X781_6960         CDS       T03026                                 

Definition
Alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mvr  Mannheimia varigena USDA-ARS-USMARC-1261
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    X781_6960
Enzymes [BR:mvr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     X781_6960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(719591..721648)
Genome map
AA seq 685 aa AA seqDB search
MKNTLPYLCLFYSSSLFAQSWQHSHFSDFNDNLEKQLFQSQVQLEKGSYPLTFKFGEQCY
QPQQTIKLNQSVTLVPCMNDAPQLRLFRQGNYMAQIDVRGGTPTLKISVEQQPQHNDSVL
QSCPNWDKKPIEIDVSSTFSEGESVRDFYSGNTAIVKNGKVTLMPDENASGLILLEKSNT
SNNATFDWKNATVYFVLTDRFYNGDPSNDHSYNRQKDGMQEIGTFHGGDLKGLTSKLDYL
QQLGVNVLWISSPLEQMHGWVGGGDKGDFPHYGYHGYYHLDWTKLDANMGTEDDLSHFVQ
QAHQRGIRVLFDVVMNHTGYATLADMQEFNFGGFYLKPEEINHTLGEKWTHWKPKSGQNW
HSFNDFIRFNDNQAWQNWWGKAWVRADIADYDSPKFDDLKMSLSALPDLKTESEQAVKLP
EFFANKNTNAKVLPNAKVRDYLISWLSDWVRKYGIDGFRVDTAKHVEKSTWLALKQSAQQ
ALNEWQQANPQASFNDNFWMTGEAWGHGVFKSDYYQNGFDAMINFDFQEQAKKGLNCFAH
IEPVYGEMSRKLSDFNVLSYLSSHDTRLFFHSDSEQNIEKQKIAANLLLLSPGAVQIYYG
DESGREFGATGSDPIQGTRSDMNWQELRQNAQKQALYQHWQKLAQFRQRHPAIGAGAHRT
IKNDSYFAFSRLLDEDKIMAIWVGN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacgttaccttacctttgcttattctactcctcaagcctttttgcccaatct
tggcaacattcccatttttctgattttaacgataatctcgaaaaacagttgtttcaatcc
caagtgcagttagaaaaaggcagctatccgcttacgtttaaatttggtgaacaatgttat
cagccccaacaaacgataaaattaaatcaatcggttacgttagtaccttgtatgaatgat
gctcctcaactacgcctatttcgtcaaggcaattatatggcacaaattgatgtgcgaggt
ggcacaccgacactaaaaatcagtgtagaacagcaaccacagcataatgactctgtactt
caaagttgcccgaattgggacaaaaaaccgattgaaattgatgtttcctctactttttcc
gaaggagaatcagtgagggatttctattcaggaaacactgccatagttaaaaacggcaaa
gttaccttaatgcctgacgaaaacgcaagcggtctaattttgctggaaaaaagcaacacc
tcaaataatgcgaccttcgattggaaaaatgctactgtctatttcgtactaaccgacaga
ttctataacggcgatcctagcaatgaccacagctacaaccgacaaaaagacggaatgcaa
gaaatcggcacatttcacggtggagatctaaaaggcttaacctcaaaattggattatcta
cagcagctaggcgtcaatgttttatggattagttccccactggagcaaatgcacggctgg
gttggcggtggtgataaaggcgattttccgcattatggatatcacggttactatcatttg
gattggacaaaattagatgccaatatgggcactgaggacgatttaagccattttgttcaa
caagcccatcaacgtggcattcgagtactgtttgatgtggtgatgaaccataccggctat
gctacgcttgcggatatgcaggaatttaactttggtggattttacctaaaaccggaggaa
atcaatcatacattaggcgaaaaatggacacattggaaacctaaatcagggcaaaactgg
catagcttcaacgattttattcgctttaatgataatcaggcttggcaaaattggtgggga
aaagcgtgggttcgtgccgatattgccgattacgacagccctaaatttgatgatttaaaa
atgtcgctctctgcccttccggatctaaaaaccgagagtgaacaagcggtcaaattacct
gaattttttgcaaataaaaataccaatgccaaagtattgccaaatgctaaagtgcgtgat
tatttaatcagttggttatcggattgggtgcgaaaatatggaattgacggctttcgggtt
gataccgccaaacacgtggaaaaatcaacgtggctggcattaaaacaatccgctcaacaa
gctttaaacgaatggcaacaagccaatccccaagccagctttaatgataacttttggatg
acaggagaggcttggggacacggcgtgttcaaaagtgattattatcaaaacggctttgat
gcaatgatcaacttcgattttcaagagcaggctaaaaaaggactaaattgctttgcccat
attgaaccggtttatggtgaaatgagccgtaaattaagcgacttcaatgtgctgagctat
ttatcttcacacgatacaagattattcttccattctgatagtgaacaaaatatcgaaaaa
caaaaaattgccgctaatttactgttgctttctcccggtgctgtgcaaatctactatggt
gatgagagcggacgagaatttggagcaaccggttcagacccgatacaaggcactcgttca
gatatgaattggcaagagttacgacaaaacgctcagaagcaggcgttgtatcaacactgg
caaaagctggcacaattccgccaacgtcatccggctattggtgctggtgctcaccgaacc
atcaaaaatgacagctattttgcatttagccgtctactggatgaggataaaattatggcg
atttgggtgggaaattaa

DBGET integrated database retrieval system