KEGG   Moritella viscosa: MVIS_2073Help
Entry
MVIS_2073         CDS       T03770                                 

Definition
(GenBank) putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mvs  Moritella viscosa
Pathway
mvs00071  Fatty acid degradation
mvs00072  Synthesis and degradation of ketone bodies
mvs00280  Valine, leucine and isoleucine degradation
mvs00310  Lysine degradation
mvs00362  Benzoate degradation
mvs00380  Tryptophan metabolism
mvs00620  Pyruvate metabolism
mvs00630  Glyoxylate and dicarboxylate metabolism
mvs00640  Propanoate metabolism
mvs00650  Butanoate metabolism
mvs00900  Terpenoid backbone biosynthesis
mvs01100  Metabolic pathways
mvs01110  Biosynthesis of secondary metabolites
mvs01120  Microbial metabolism in diverse environments
mvs01130  Biosynthesis of antibiotics
mvs01200  Carbon metabolism
mvs01212  Fatty acid metabolism
mvs02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mvs00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MVIS_2073
   00630 Glyoxylate and dicarboxylate metabolism
    MVIS_2073
   00640 Propanoate metabolism
    MVIS_2073
   00650 Butanoate metabolism
    MVIS_2073
  Lipid metabolism
   00071 Fatty acid degradation
    MVIS_2073
   00072 Synthesis and degradation of ketone bodies
    MVIS_2073
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MVIS_2073
   00310 Lysine degradation
    MVIS_2073
   00380 Tryptophan metabolism
    MVIS_2073
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MVIS_2073
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MVIS_2073
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MVIS_2073
Enzymes [BR:mvs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MVIS_2073
Exosome [BR:mvs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MVIS_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CED60036
UniProt: A0A090IDH5
Position
1:2368631..2369911
Genome map
AA seq 426 aa AA seqDB search
MTGQTVRRVAIIGGNRIPFARSNTAYSKLSNQDMLTESIRGLVVKYGLRGEQLGEVVAGA
VIKHSRDFNLTREAVLSAGLAPETPCYDIQQACGTGLAAAIQVANKIALGQIEAGIAGGS
DTTSDAPIAVSEGMRSVLLELNRAKTGKQRLSALSRLRPKHFVPLTPANKEPRTKMAMGD
HCQVTAKEWNISREAQDELACASHQKLAAAYEEGFFDTLVSPMAGLTKDNVLRADTTVEK
LAKLKPCFDKVNGTMTAGNSTNLTDGASAVLLASEEWAAEHNLPVQAYLTFGETAAVDFV
DKKEGLLMAPAYAVPKMLKRAGLTLQDFDFYEIHEAFAAQVLSTLAAWEDEKFCKEKLGL
DAPLGSIDLTKLNVKGSSLATGHPFAATGGRVIATLAQLLDQKGSGRGLISICAAGGQGI
TAILEK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacaggtcaaacagtaagaagagttgcaattatcggcggtaaccgtatcccgtttgca
cgttcaaatacagcatattcgaaactaagtaaccaagatatgcttacggaaagtatccgt
ggcttagtggttaaatatggcctacgtggtgaacaacttggtgaagttgttgcgggtgcg
gtaattaaacactctcgtgattttaacttaacacgtgaagcggtattaagtgcaggcctt
gcacctgaaacaccttgttatgacatccaacaagcatgtggtactggtttagccgctgcc
attcaagtagcaaacaagattgcactgggtcaaattgaagcgggtattgctggtggttct
gataccacgtctgatgcaccgattgctgtaagtgaaggtatgcgcagtgttttacttgag
ttgaaccgtgctaaaacgggtaaacaacgcttgagtgcactttctcgtttacgtccaaaa
catttcgtgccacttacacctgcgaataaagaaccgcgtacaaaaatggcgatgggcgat
cattgtcaagtgactgcgaaagaatggaatatctcacgcgaagcacaagatgaattagca
tgtgccagtcatcaaaaattagcggctgcatatgaagaaggtttcttcgatacgttggtg
tcacctatggctggactaacgaaagataatgtattacgtgctgacacgacagttgaaaaa
ctagctaaattaaagccttgttttgataaagtaaatggcactatgacggcgggtaacagt
actaaccttacggacggtgcatctgcggtattacttgcaagtgaagagtgggcagctgaa
cacaacttacctgttcaagcttatttaacatttggtgaaacagcggctgttgactttgtt
gataaaaaagaaggtctgttaatggctcccgcatatgcagtaccaaaaatgcttaagcgt
gcaggtctaacattacaagatttcgatttttatgagattcatgaagcatttgcagcgcaa
gtactatcaacgctagctgcgtgggaagatgagaaattctgtaaagaaaaacttggtctt
gatgcaccgcttggttcaatcgatttaactaagttaaacgtgaaaggcagtagtttagct
acgggtcatccatttgctgcaaccggtggtcgtgttattgctacgttagcgcagttgctt
gatcagaaaggttcaggtcgtggtttaatctcgatctgtgctgctggtggtcaaggtatc
acggctattttagaaaaataa

DBGET integrated database retrieval system