KEGG   Methanocaldococcus vulcanius: Metvu_0111Help
Entry
Metvu_0111        CDS       T01105                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Organism
mvu  Methanocaldococcus vulcanius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(117775..118878)
Genome map
AA seq 367 aa AA seqDB search
MIMQYIYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALADLLPEIEV
VENCPFNCDPNGDLCDICKEKKERGELRTIKKKMKVVNLPIGATEDRVIGTLDIEKAIKE
GIKALEPGILAEANRNILYIDEVNLLDDHIIDVLLDAAAMGWNIIEREGVKIKHPSRFIL
VGTMNPEEGELRPQILDRFGLMVDVEGLNDVKERVEVIKRVEEFNENPEAFYKKFEEEQN
KLRDRIIKARELLKDVEISDDLLEFISKVCIELGIQTNRADITVVRTAKALSAYNGRTEV
ILEDVKEAMELALPHRMRRKPFEPPQLNKEKLEQMINEFKQENDKNENENKEKEDQKDDD
VKKNMMK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcagtatatttatccatttacagcaatagttggacaggaaaagatgaagaag
gcattaatcttaaatgcaataaatcctaagatcggcggtgtcttaattagaggagagaaa
gggactgcgaaatccaccgctgttagagctttggctgatctgttgccagagattgaggtt
gttgaaaactgtccattcaactgcgatccaaatggagacctatgcgatatttgcaaagaa
aagaaagagagaggagaactaagaactataaaaaagaagatgaaagttgttaatctccca
attggagctacggaagatagggttatcggaacattggatatagagaaggcaataaaagaa
ggaattaaagcattagagccaggaattttagcagaggcaaatagaaatatcctatacatt
gatgaagttaatttactggatgaccatataattgatgtgttgttggatgctgcagcgatg
ggctggaatatcattgagagggaaggagttaagataaagcatccttcaagatttatatta
gtagggactatgaacccagaggaaggggagttgagaccccaaatcttagatagatttggt
ttaatggtcgatgttgaagggctgaatgatgttaaggaaagagtagaggttataaagaga
gttgaggaattcaacgaaaatccagaggcattttataagaaatttgaggaagagcagaac
aaattaagagatagaataattaaagcaagagaacttttaaaagatgttgagataagtgat
gatctcttagaatttatatcaaaggtttgtattgagttaggaattcagacaaatagggca
gatataactgttgttagaacagctaaggcgttatctgcttataatggaagaacagaagtt
attttagaggatgttaaagaggcaatggagttggctctcccacatagaatgagaagaaag
ccgtttgaaccaccacaattaaataaggagaagttggagcagatgattaatgaatttaaa
caggaaaatgataaaaatgaaaatgagaataaagaaaaagaagatcaaaaagatgatgac
gtaaaaaaaaacatgatgaaataa

DBGET integrated database retrieval system