KEGG   Methanocaldococcus vulcanius: Metvu_0111Help
Entry
Metvu_0111        CDS       T01105                                 

Definition
(GenBank) Magnesium chelatase
Organism
mvu  Methanocaldococcus vulcanius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 AAA_22 AAA DUF853
Motif
Other DBs
NCBI-ProteinID: ACX71979
JGI: Metvu_0111
UniProt: C9REH7
Position
complement(117775..118878)
Genome map
AA seq 367 aa AA seqDB search
MIMQYIYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALADLLPEIEV
VENCPFNCDPNGDLCDICKEKKERGELRTIKKKMKVVNLPIGATEDRVIGTLDIEKAIKE
GIKALEPGILAEANRNILYIDEVNLLDDHIIDVLLDAAAMGWNIIEREGVKIKHPSRFIL
VGTMNPEEGELRPQILDRFGLMVDVEGLNDVKERVEVIKRVEEFNENPEAFYKKFEEEQN
KLRDRIIKARELLKDVEISDDLLEFISKVCIELGIQTNRADITVVRTAKALSAYNGRTEV
ILEDVKEAMELALPHRMRRKPFEPPQLNKEKLEQMINEFKQENDKNENENKEKEDQKDDD
VKKNMMK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgattatgcagtatatttatccatttacagcaatagttggacaggaaaagatgaagaag
gcattaatcttaaatgcaataaatcctaagatcggcggtgtcttaattagaggagagaaa
gggactgcgaaatccaccgctgttagagctttggctgatctgttgccagagattgaggtt
gttgaaaactgtccattcaactgcgatccaaatggagacctatgcgatatttgcaaagaa
aagaaagagagaggagaactaagaactataaaaaagaagatgaaagttgttaatctccca
attggagctacggaagatagggttatcggaacattggatatagagaaggcaataaaagaa
ggaattaaagcattagagccaggaattttagcagaggcaaatagaaatatcctatacatt
gatgaagttaatttactggatgaccatataattgatgtgttgttggatgctgcagcgatg
ggctggaatatcattgagagggaaggagttaagataaagcatccttcaagatttatatta
gtagggactatgaacccagaggaaggggagttgagaccccaaatcttagatagatttggt
ttaatggtcgatgttgaagggctgaatgatgttaaggaaagagtagaggttataaagaga
gttgaggaattcaacgaaaatccagaggcattttataagaaatttgaggaagagcagaac
aaattaagagatagaataattaaagcaagagaacttttaaaagatgttgagataagtgat
gatctcttagaatttatatcaaaggtttgtattgagttaggaattcagacaaatagggca
gatataactgttgttagaacagctaaggcgttatctgcttataatggaagaacagaagtt
attttagaggatgttaaagaggcaatggagttggctctcccacatagaatgagaagaaag
ccgtttgaaccaccacaattaaataaggagaagttggagcagatgattaatgaatttaaa
caggaaaatgataaaaatgaaaatgagaataaagaaaaagaagatcaaaaagatgatgac
gtaaaaaaaaacatgatgaaataa

DBGET integrated database retrieval system