KEGG   Methanocaldococcus vulcanius: Metvu_0164Help
Entry
Metvu_0164        CDS       T01105                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mvu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(166249..167769)
Genome map
AA seq 506 aa AA seqDB search
MCSISGIIVKENPISSKYSIDMMRILKHRGRDNSGLLIDEDVIYFEKFDDIKDIEKEEIK
NITLGHNRLAIVGRYGVQPIPNEDESAWIVCNGEIYNYIELRDYLKQNHEFRTDSDNEVI
IHLYEEEKLNEIDGDYAFALYDKSKNIVILARDTFGVKPLFYVDRKEYFAFASERKALWH
LLINIDGLDKDLDLLNKEIKRIKPNSQLIYYLDDDRFEIIEEFKKIKSNYMSQHDYSTAK
EYLDKALKRAVLKRVRGLDRVGIICSGGVDSSLIAKLSSLYCDVILYAVGIENSEDIIYA
ERLAKDLNLPIRKKIISEDEYEKYVFKVAKAIDEVDLMKIGVGIPIYVASEMASEDGLKV
VLSGQGADELFGGYARYERIFREKGAEMLKEELLKDIKNLHSVNLERDDHCTMANGVELR
VPFLDEEVVEIALSIPVEYKISELRKKILRDVASKYLPDYIAFRPKKAAQYGSGGEKIVY
KVAKKFGYSKKKINEFLDLLKNKIIN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtgttccataagtggaataattgtaaaagaaaatccaatatcaagcaaatactcaata
gacatgatgagaattttaaaacatagggggagagataattcaggcctactaattgatgaa
gacgttatatattttgaaaaattcgatgatattaaagatatagaaaaagaagagataaaa
aacataaccttagggcacaatagattagcaatcgtaggtagatatggagttcagccaata
ccgaacgaagatgaaagtgcatggatagtgtgtaatggagaaatatataattatatcgaa
ttaagggactatctaaaacaaaatcatgaatttaggactgacagtgataatgaagttatc
attcacttatatgaagaagaaaaactaaatgagattgatggggactatgcatttgccctg
tatgacaaatctaaaaatattgttatattggcaagagatacatttggagttaaacccctc
ttctatgtagataggaaggaatactttgcatttgcttctgaaagaaaagcactgtggcat
ttgcttataaacattgatggattagataaggacttagatctgctaaataaagaaataaaa
cgaataaaaccaaattctcaattaatatactaccttgatgatgataggtttgagattata
gaagagtttaaaaaaataaaatctaattatatgtctcagcatgattatagcacagcaaaa
gaatacttagataaagcattaaaaagagcagttttaaaaagagttagaggtttagataga
gtagggattatatgctccggaggggtcgatagctcattaattgctaaattatcatcatta
tattgtgatgtcatactttacgcagttggaattgaaaatagcgaggatataatttatgcg
gaaagattagccaaggacttaaacctcccaataagaaaaaaaataatatccgaagatgaa
tatgaaaaatacgtgtttaaagtagccaaggcaatagacgaagtcgatctaatgaaaata
ggtgttggaattccaatatatgtagcttccgaaatggcaagtgaagacggattgaaagtt
gtgttatcgggtcagggagctgatgagttatttggtggatatgcaaggtatgaacgaatt
tttagagagaaaggagctgaaatgttaaaagaagaattactaaaagatataaaaaacctt
cactcagtaaatttagagagagacgatcactgcacaatggcaaacggtgttgagttaaga
gttccgtttttagatgaagaagttgtagagattgcgttatctattccagtggaatataaa
atctcagaactaagaaagaagatcttaagagatgttgcttccaaatatcttcctgactat
atcgcatttagacccaaaaaagctgctcagtatggaagtggaggggagaagattgtatac
aaagttgccaaaaaatttggatattcaaaaaagaaaattaacgagtttttagatctttta
aaaaataaaataataaattaa

DBGET integrated database retrieval system