KEGG   Methanocaldococcus vulcanius: Metvu_0257Help
Entry
Metvu_0257        CDS       T01105                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Metvu_0257
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Metvu_0257
Enzymes [BR:mvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Metvu_0257
Two-component system [BR:mvu02022]
 CheA family
  CheA-CheYBV
   Metvu_0257
Bacterial motility proteins [BR:mvu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Metvu_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
249784..250893
Genome map
AA seq 369 aa AA seqDB search
MASKKIRVLVVDDSAFMRKVISDILNSDPEIEVIGTAKDGVEAVELVQKLEPDVITMDVE
MPRMNGLEAVKKIMEIKPTPIVMLSALTKEGSKITFEALEAGAVDFISKPSGSISLDIRK
IGEDIIKKVKQAAKAKVVKKISTTRHKPTTIKEEKEEKKTLPQTSEELTVPDSKLKEMCV
IIGSSTGGPPVVTEIISKLPKRMPPIFVVQHMPPGFTKLFADRINQVSKLNVKEAEHGER
VMPGYVYIAPGDYHMLLTKRGENVYISLDNKMPKVNGTRPAVDITAESVANIYGGKSVGV
ILTGIGKDGAYGFKKIKEKGGKIIAQDGKTCVVFGMPKAVIELGIADLVLPPSEIPEAIV
KFCKEILGG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaaaaagatcagagtgttggtagtggatgattccgcatttatgaggaaagtt
atctccgatatattaaactcagatccagagattgaagttataggcactgcaaaagatggg
gtagaagctgtcgaacttgttcaaaaattggaacctgatgttataacgatggatgtagaa
atgccaagaatgaacggattagaggccgtgaaaaaaataatggaaataaaaccaacacca
atcgtcatgttatctgctctaacaaaagaaggatctaaaataacatttgaagcactcgaa
gcaggagcagtggattttatttcaaaaccatcaggaagtatatcgttagatataaggaag
ataggggaagatataattaaaaaggttaaacaggcagcaaaagccaaagtagttaaaaag
atctcaacaacaagacataaaccaacaacaattaaagaagagaaagaagagaaaaaaaca
ctaccacaaacatctgaagaattaacagttccagatagtaagttaaaagagatgtgtgta
ataatcggctcttcaacaggaggaccaccagtagttacggaaattatatcaaaacttcca
aagagaatgcctccaatatttgtggttcaacacatgcctcctggatttaccaagttattc
gctgatagaataaatcaggtctcaaaacttaatgttaaagaagcggaacatggagaaaga
gttatgcctggctatgtttatatagctcctggagattaccacatgctcttaacaaaaaga
ggggaaaatgtttacatttcccttgacaataaaatgccaaaagttaacggaacaagacca
gctgttgatataactgcggaatctgttgccaatatatacggtggaaagtcggtgggggtt
attttaacaggtattgggaaagatggggcttatggatttaaaaaaataaaagaaaaagga
ggaaaaattatagcccaagatggaaaaacatgtgttgtttttggaatgcctaaggccgtt
attgaattagggatagctgatttggtcctccccccatcagaaattcccgaagcgattgtg
aaattctgcaaagagatcttggggggataa

DBGET integrated database retrieval system