KEGG   Methanocaldococcus vulcanius: Metvu_0291Help
Entry
Metvu_0291        CDS       T01105                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Metvu_0291
Enzymes [BR:mvu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Metvu_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(278721..280232)
Genome map
AA seq 503 aa AA seqDB search
MLFLKVRVLDIDLENLVLINFEDLKNSQYFPQDRVVVEFKGKEVIGILHSSTTLINRGEI
GLPKKIVSELGVKEGDVVTIKHAEKPRSLPYIRKKMDGNKLKKEEIFEIIDEMVEGKLTN
IEISAFVTSLYINGMDMDEIEAMTIRMAETGKMVNWEGHIFDVHSIGGVPGNKYALLVVP
IVASTGLKIPKTSSRAITSAAGTADVVEVLTRVDLTIEEIKKVVKETNGCMVWGGALDLA
PADDITINVERPLGIDPEPLLLSSVMAKKLAMGVNKLLIDIPTGYGAKVKTVKEASSLAR
KFIELSDRLRILTECAITYGGQPIGRAIGPALEAREALVALEDYKQAPTSLIEKSLSLAG
ILLEMGGVAPFGEGKDLAEEILASGKAHDKFMEIIVAQGGKEVSSDDIELGKYSADIHSP
IDGYVTKISNAGITKLAKEAGAPNDKKAGIYLNVKVGNKVEKGDVLYTIYSDSEERLKSA
VKLARIVYPIKVEGMLLQRISRF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgctatttctaaaagttagagtattagacattgatttagaaaacctggttttaataaat
ttcgaagacctaaaaaactcgcaatactttcctcaagatagagttgtagtggagtttaaa
ggaaaagaggttatagggattttacattcttcaacaacgttaataaacagaggagaaatt
ggcttacctaaaaagattgtctctgaacttggagtaaaagaaggggatgtagttacgata
aaacatgcggaaaaaccaaggtctcttccttatataagaaaaaagatggatggtaataaa
ttaaaaaaagaagagatttttgaaattatagatgaaatggtagagggtaagttaacaaat
atagaaatatctgcttttgtaacgtctttatacattaacggaatggacatggatgaaatc
gaagcaatgacaataagaatggctgagacaggaaaaatggttaattgggagggacatatc
tttgatgtgcattccattggaggtgttccaggtaataaatatgctctgctggtagtgcca
atagttgcatctactggactaaaaattccaaaaacatcttcaagagcaataacatcagcg
gcaggaacggcagatgttgttgaggttttaacaagagtggatctaacgattgaagaaata
aaaaaagtagttaaagagacaaacggttgtatggtatggggaggggctctggatttagct
cctgcggatgatattacaataaacgttgagagacctcttggaatagatcctgaacctctt
cttctgtcaagtgtaatggcaaaaaaattggcaatgggtgttaacaagttgttaatagat
attcccacaggttatggagcaaaggttaagacagtaaaagaggcgtcaagtttagcaaga
aagtttatagagttgagtgatagattaagaatacttaccgaatgtgcaataacttacggt
ggacagccgattggaagagcaataggtcctgcattagaagcgagagaagcacttgtggca
ttagaggattataaacaagccccaacaagtttgattgaaaaatctttatccttggcagga
attttattagaaatgggtggagtcgcaccgtttggagagggtaaagatcttgcggaggaa
attttagcgagtggaaaagcccatgataaatttatggagattatagtagcccagggagga
aaagaagttagttcggatgatattgaattgggaaaatactctgctgacattcactctcca
atagatggatatgttacaaagatctcaaatgctgggataacaaaacttgcaaaagaagcg
ggagctccaaatgataaaaaagcaggcatctatctaaacgtaaaagttgggaataaggta
gaaaaaggggatgttctttatacaatatactctgattcagaagaaagattaaaatcagct
gttaaattagcgaggatagtgtatcctataaaagttgagggaatgttgcttcaacgaatc
tcgcgattttaa

DBGET integrated database retrieval system