KEGG   Methanocaldococcus vulcanius: Metvu_0368Help
Entry
Metvu_0368        CDS       T01105                                 

Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00010  Glycolysis / Gluconeogenesis
mvu00030  Pentose phosphate pathway
mvu00051  Fructose and mannose metabolism
mvu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mvu00680  Methane metabolism
mvu01100  Metabolic pathways
mvu01110  Biosynthesis of secondary metabolites
mvu01120  Microbial metabolism in diverse environments
mvu01130  Biosynthesis of antibiotics
mvu01200  Carbon metabolism
mvu01230  Biosynthesis of amino acids
Module
mvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_0368
   00030 Pentose phosphate pathway
    Metvu_0368
   00051 Fructose and mannose metabolism
    Metvu_0368
  Energy metabolism
   00680 Methane metabolism
    Metvu_0368
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metvu_0368
Enzymes [BR:mvu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Metvu_0368
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metvu_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: ACX72233
JGI: Metvu_0368
UniProt: C9RF81
Position
complement(350387..351304)
Genome map
AA seq 305 aa AA seqDB search
MIKKLKKRDIKVPLTVPESVKKEYINNYLDLTKKTGNVMIFAGDQKIEHLNDDFFGEGIA
KDDASPDHLFNIASKGKICAFATQLGLIARYGMDYGKIPYIVKINSKTHLVKTRDPISRA
LVSVKDVVNFKENSGLNILGVGYTIYPGSEYEHIMFEEASRVILEAHKHGLIAIIWSYPR
GKNVENERDPHLIAGAAGVATCLGADFVKVNYPKCDNPAEKFKEAILAAGRTGVLCAGGK
SIDPEKFLRQIWEQIHISGARGNATGRNIHQKPLDQAIRMCNAIYAITIEGKSLEEALKI
YYGEE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaacttaaaaaaagagatataaaagttcctttaacagttccagaaagcgtt
aaaaaagaatacataaataattacttagatctaactaaaaaaaccggaaacgttatgata
tttgcaggagatcaaaaaatagaacatttaaatgatgacttctttggggagggaattgcc
aaagatgacgcatctcctgatcatctcttcaatatagcaagtaaaggaaagatctgtgca
tttgcaacacaactcggattaatagcaaggtatggaatggattatggaaaaataccctat
attgtaaagatcaactcaaaaacccacttagttaaaaccagagatccaataagcagggca
ttggtctctgtaaaagacgttgtaaactttaaagagaactctggattaaacatccttgga
gtgggatatacaatttatccaggaagcgaatatgagcatataatgtttgaagaggcatcg
agagttatattagaggcacataaacatggattaattgcaataatatggagttatccaagg
ggaaaaaatgtagaaaatgagagagatccgcatttaatagcaggagctgctggtgttgct
acatgcttaggagccgattttgttaaagttaactatccaaagtgtgataatccagcagaa
aaatttaaagaggcaatattagccgctggaagaacgggagttttatgtgcaggagggaag
agcatagatccagaaaagtttttaaggcagatctgggagcaaattcacataagtggagca
cgaggaaacgcaacagggagaaatatccatcaaaaaccattagatcaggcaattagaatg
tgtaatgcaatatatgcaataacaattgaaggaaaaagtttagaagaagctttgaaaata
tattatggagaagaataa

DBGET integrated database retrieval system