KEGG   Methanocaldococcus vulcanius: Metvu_0368Help
Entry
Metvu_0368        CDS       T01105                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metvu_0368
   01230 Biosynthesis of amino acids
    Metvu_0368
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_0368
   00030 Pentose phosphate pathway
    Metvu_0368
   00051 Fructose and mannose metabolism
    Metvu_0368
  Energy metabolism
   00680 Methane metabolism
    Metvu_0368
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metvu_0368
Enzymes [BR:mvu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Metvu_0368
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Metvu_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(350387..351304)
Genome map
AA seq 305 aa AA seqDB search
MIKKLKKRDIKVPLTVPESVKKEYINNYLDLTKKTGNVMIFAGDQKIEHLNDDFFGEGIA
KDDASPDHLFNIASKGKICAFATQLGLIARYGMDYGKIPYIVKINSKTHLVKTRDPISRA
LVSVKDVVNFKENSGLNILGVGYTIYPGSEYEHIMFEEASRVILEAHKHGLIAIIWSYPR
GKNVENERDPHLIAGAAGVATCLGADFVKVNYPKCDNPAEKFKEAILAAGRTGVLCAGGK
SIDPEKFLRQIWEQIHISGARGNATGRNIHQKPLDQAIRMCNAIYAITIEGKSLEEALKI
YYGEE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaacttaaaaaaagagatataaaagttcctttaacagttccagaaagcgtt
aaaaaagaatacataaataattacttagatctaactaaaaaaaccggaaacgttatgata
tttgcaggagatcaaaaaatagaacatttaaatgatgacttctttggggagggaattgcc
aaagatgacgcatctcctgatcatctcttcaatatagcaagtaaaggaaagatctgtgca
tttgcaacacaactcggattaatagcaaggtatggaatggattatggaaaaataccctat
attgtaaagatcaactcaaaaacccacttagttaaaaccagagatccaataagcagggca
ttggtctctgtaaaagacgttgtaaactttaaagagaactctggattaaacatccttgga
gtgggatatacaatttatccaggaagcgaatatgagcatataatgtttgaagaggcatcg
agagttatattagaggcacataaacatggattaattgcaataatatggagttatccaagg
ggaaaaaatgtagaaaatgagagagatccgcatttaatagcaggagctgctggtgttgct
acatgcttaggagccgattttgttaaagttaactatccaaagtgtgataatccagcagaa
aaatttaaagaggcaatattagccgctggaagaacgggagttttatgtgcaggagggaag
agcatagatccagaaaagtttttaaggcagatctgggagcaaattcacataagtggagca
cgaggaaacgcaacagggagaaatatccatcaaaaaccattagatcaggcaattagaatg
tgtaatgcaatatatgcaataacaattgaaggaaaaagtttagaagaagctttgaaaata
tattatggagaagaataa

DBGET integrated database retrieval system