KEGG   Methanocaldococcus vulcanius: Metvu_0373Help
Entry
Metvu_0373        CDS       T01105                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00051  Fructose and mannose metabolism
mvu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Metvu_0373
Enzymes [BR:mvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Metvu_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACX72237
JGI: Metvu_0373
UniProt: C9RF85
Position
complement(355783..356328)
Genome map
AA seq 181 aa AA seqDB search
MDKKLFIKICKMLYDRKYVVGSGGNVSVREDEKVYLTPTGSILGFLREEDIAEIDLRGNI
IKGNPTSEKNLHLALYKKRKDINAIIHTHSIISTFLSTMDREIELLTPEGKIFLKKIGYV
DYFEAGSLKLAEEAGKRDEDVILLKNHGVVCLGKDLLDAYIKVEVLEEQAKLTLLKYLFE
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaaagttatttattaaaatatgtaagatgctatacgatagaaaatatgttgtt
ggaagtggaggaaatgtttctgttagagaagatgaaaaagtgtatctaaccccaacgggt
tccattttaggttttctgagagaggaagatattgcagaaatcgatctcagaggaaatatt
ataaaaggaaatcccacatcagaaaaaaatctccacttagcattatataaaaagagaaaa
gatattaacgcaataatccatacccactcgattatttccacatttttatctacaatggat
agggagattgaactattaactcccgagggtaaaatattcctaaaaaagattggatatgtt
gactatttcgaggcagggagcttaaaattagcagaagaggcaggaaaaagagacgaagat
gtaattttactaaaaaatcatggtgttgtttgcttgggaaaggatctgcttgacgcatat
ataaaagttgaggtcttagaagagcaggcaaaactaacgcttttaaaatatctttttgaa
agataa

DBGET integrated database retrieval system