KEGG   Methanocaldococcus vulcanius: Metvu_0373Help
Entry
Metvu_0373        CDS       T01105                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Metvu_0373
Enzymes [BR:mvu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Metvu_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(355783..356328)
Genome map
AA seq 181 aa AA seqDB search
MDKKLFIKICKMLYDRKYVVGSGGNVSVREDEKVYLTPTGSILGFLREEDIAEIDLRGNI
IKGNPTSEKNLHLALYKKRKDINAIIHTHSIISTFLSTMDREIELLTPEGKIFLKKIGYV
DYFEAGSLKLAEEAGKRDEDVILLKNHGVVCLGKDLLDAYIKVEVLEEQAKLTLLKYLFE
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtggataaaaagttatttattaaaatatgtaagatgctatacgatagaaaatatgttgtt
ggaagtggaggaaatgtttctgttagagaagatgaaaaagtgtatctaaccccaacgggt
tccattttaggttttctgagagaggaagatattgcagaaatcgatctcagaggaaatatt
ataaaaggaaatcccacatcagaaaaaaatctccacttagcattatataaaaagagaaaa
gatattaacgcaataatccatacccactcgattatttccacatttttatctacaatggat
agggagattgaactattaactcccgagggtaaaatattcctaaaaaagattggatatgtt
gactatttcgaggcagggagcttaaaattagcagaagaggcaggaaaaagagacgaagat
gtaattttactaaaaaatcatggtgttgtttgcttgggaaaggatctgcttgacgcatat
ataaaagttgaggtcttagaagagcaggcaaaactaacgcttttaaaatatctttttgaa
agataa

  All links  
No link information was found.   
DBGET integrated database retrieval system