KEGG   Methanocaldococcus vulcanius: Metvu_0380Help
Entry
Metvu_0380        CDS       T01105                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Metvu_0380
Enzymes [BR:mvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Metvu_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
361456..362190
Genome map
AA seq 244 aa AA seqDB search
MKVVITRPKERAEAFSTILKKENFDPIIFPTLKLEYNKDLKIDLDEYGWIIFTSPSGVIG
LNNILSEKEKENVKDKKIAAIGEKTAKMVKKIFGKYPDIVPKQYTAECLLEEIKKRADKN
DRFLVPTTPSTRDILKNNLNADLVFVYKSVEPENLKENMEVLKETLKNEERFIITFTSGL
TAKNFFKYVDDEFYQMIKNNYIVAIGPITAKVIQKFGINPKIPDKYTIEGMLEVIKSIRR
ENNI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagttataacaaggccaaaagaaagagcagaagcattttcaactattttaaaa
aaagaaaacttcgatccaataatctttccaacattaaagttagaatacaataaagatcta
aaaattgatttagatgaatatggttggattatttttacatcaccaagtggtgtgattgga
cttaacaacatactgtcagaaaaagaaaaagaaaatgttaaagataaaaaaattgccgca
ataggagaaaaaaccgcaaaaatggttaaaaaaatatttggaaagtatccagatattgtt
ccaaagcaatatactgctgaatgtttgttagaagaaataaaaaaacgtgctgataaaaac
gatagatttttagtgccgacaacaccatcaacaagagatattttaaaaaataacctaaat
gcagatttagtatttgtttataaatcggtagagccagaaaatttaaaagaaaatatggaa
gtattaaaagaaacattaaaaaacgaggagaggtttattataacctttacaagtggctta
actgcgaaaaatttttttaaatatgtagatgatgaattttaccaaatgattaaaaataac
tatattgttgcgatagggccaattacagcaaaagttattcaaaaatttggaattaatcca
aaaattccagataaatatacgattgaaggaatgttggaagttattaaatcaattagaaga
gaaaataacatttaa

DBGET integrated database retrieval system