KEGG   Methanocaldococcus vulcanius: Metvu_0390Help
Entry
Metvu_0390        CDS       T01105                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00010  Glycolysis / Gluconeogenesis
mvu01100  Metabolic pathways
mvu01110  Biosynthesis of secondary metabolites
mvu01120  Microbial metabolism in diverse environments
mvu01130  Biosynthesis of antibiotics
mvu01200  Carbon metabolism
mvu01230  Biosynthesis of amino acids
Module
mvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mvu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_0390
Enzymes [BR:mvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Metvu_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C Sacchrp_dh_NADP DUF5498
Motif
Other DBs
NCBI-ProteinID: ACX72253
JGI: Metvu_0390
UniProt: C9RFA1
Position
complement(369734..370765)
Genome map
AA seq 343 aa AA seqDB search
MSAKVLINGYGSIGKRVADAVAVQDDMEVIGVSKTKPDFEARLAVEKGYKLFVAVPDRER
IKLFEEAGIPVEGTILDVIEEADIVVDGAPKKIGKQNLENIYKPNKVKAILQGGEKAKDV
EDSFNALWSFDRCYGKDYIRVVSCNTTGLCRILYAINEVSNIKKARVVLVRRAADPNDDK
TGPINAITPNPVTVPSHHGPDVVSVVPELEGKILTSAVIVPTTLMHQHTLMVEVDDNISR
EDVLDSILKTPRIITVKAEDGFTSTAKIIEYGRDIGRLRYDINELVIWEESVNVLDREIF
LMQAVHQESIVVPENIDCIRAMLQMEDDKFKSIEKTNKAMGIK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaggttttaataaatgggtatggatctattggaaaaagagtagctgatgct
gtggcagttcaggatgatatggaagttataggagtcagtaaaaccaagccagattttgaa
gcaagattggctgttgagaagggatacaagctttttgtagcagttcctgacagagaaaga
ataaaactatttgaagaggcaggtattccagtagagggaactattttagatgttatagaa
gaagcagatattgtcgttgatggagcccccaaaaaaattggtaaacaaaacttggaaaac
atatataaaccaaacaaggttaaagccatattacagggaggggaaaaagcgaaagatgtg
gaggatagctttaacgcattgtggagttttgatagatgctatggaaaggactatattagg
gttgtttcttgcaacacaaccgggttgtgtaggatcttatatgcaataaacgaagtatcc
aacataaaaaaagcaagagttgtgttagttaggagagcggcagatccaaacgatgataaa
actgggcctataaatgcgataactcctaatccagtaacggttccttcgcatcatggtcca
gatgttgtttcagttgttccagaacttgaagggaagatcttaacatctgcggttatagtt
ccaacaacattgatgcatcaacacacattgatggtggaggttgatgacaatatcagtaga
gaagatgttttagattccattttaaaaactccaaggattataactgttaaagcagaggac
ggattcacttcaacagccaaaataatcgaatatggaagagatattggaagattgagatat
gatataaatgaacttgtgatttgggaggagagtgttaacgtattagacagagagatcttt
ttaatgcaggccgttcatcaagaaagtattgtagttccagaaaatatcgattgtataagg
gctatgcttcaaatggaagatgacaagtttaaatcaatagaaaaaacaaacaaagcgatg
ggaataaaataa

DBGET integrated database retrieval system