KEGG   Methanocaldococcus vulcanius: Metvu_0754Help
Entry
Metvu_0754        CDS       T01105                                 

Definition
(GenBank) nitrite and sulphite reductase 4Fe-4S region
  KO
K21816  sulfite reductase (coenzyme F420) [EC:1.8.98.3]
Organism
mvu  Methanocaldococcus vulcanius
Brite
Enzymes [BR:mvu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, physiological acceptors
    1.8.98.3  sulfite reductase (coenzyme F420)
     Metvu_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FrhB_FdhB_C NIR_SIR FrhB_FdhB_N Fer4 Fer4_7 Fer4_2 NIR_SIR_ferr Fer4_6 Fer4_21 Fer4_8 Fer4_9 Fer4_10 Fer4_16 Fer4_18 Fer4_17 Fer4_22 Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ACX72612
JGI: Metvu_0754
UniProt: C9RGB0
Position
complement(718182..720035)
Genome map
AA seq 617 aa AA seqDB search
MYEWKLNEIVDGNMCARCGTCTVVCPNNLLTFEDRPKLKDECLRKGNGMCFEVCPRVSSG
KYQIKIRENFFEKYYYGKSEIEGQDGGVVTAFLKYLLENGKIDGAIVVGDECWKPISMAV
QNADDLLKSTKSKYAVSTLDALRKAGEMGLEKVAVVGLPCQINGLRKLQYFPYLAKHDFE
LGRDGKPVKLPKIEYLIGLFCMEKFKYDNMKEVLERHGIKIEDVKKFDIKKGKLIVYLEN
DKKEIKLEEFEVCSGCNICRDFDAGMADVSVGCVGSPDGYSTIIIRTKKGEEIKNAIELK
EGVDVEAINKLRNKKLKRFKKEVERRKETGEYISFYWIADYGGIGKRADGNYFIRIRAKP
GGWYKPEEIKEILNIAEEYGAKIKITDRGAYEIHGISGFDAEDIVLRLRGKGLLTGSEGP
LVRATLACPGGGNCSSGLINTTELANLIEDKFKERPAPYKFKIAISGCPNCCVRPQIHDV
GIVGVKYPKVNEENCNGCGRCAEVCKIEAIDIRGEMSYTNYNVCIGCGKCIKNCPNEARE
VKEEGYLVYVGGKTGREVVKGIKMKLMSVEEILNFIDKVLVVYGKYAEKPQRERLSAVMK
RVGYEKFLEDVRKLMKE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatggaagttgaacgaaattgtagatggtaatatgtgtgcaagatgtggaact
tgcacggttgtatgtccaaataacctattaacatttgaagatagaccaaaattaaaagat
gagtgtttgagaaaaggaaatgggatgtgttttgaagtttgtccgagagtttcatctgga
aaatatcaaataaaaataagagaaaacttttttgaaaaatactattatggaaagagtgag
attgaaggacaggatggtggagttgttactgcctttttaaaatacctcttagaaaatggg
aagatagatggagccatagttgttggggatgaatgctggaaaccaatctcaatggctgtc
caaaatgcagatgacttattaaaatctacaaaatcaaaatatgctgtctcaacgttagat
gctttgaggaaagcaggagaaatggggttagaaaaagttgctgttgttggtttgccatgt
caaattaacggtttaaggaagttgcagtatttcccatacttggcaaaacatgattttgaa
cttggaagagatggaaagcccgtaaagctacctaagatagagtatttaattggattattc
tgtatggaaaaattcaaatatgacaatatgaaagaggtcttggaaagacatggaataaaa
attgaagatgttaaaaaatttgacattaaaaaaggaaaacttattgtttacttagaaaat
gataaaaaagaaattaaattagaggaatttgaggtctgttctggatgtaatatatgtagg
gactttgatgcaggaatggcagatgtttcagttggatgtgttggaagtccagatggttat
tcaacaatcataataagaactaaaaagggagaagaaattaaaaatgccattgaattaaaa
gaaggtgttgatgtagaggcaattaataaattaaggaataaaaaattaaagagatttaaa
aaagaagttgaaagaagaaaagaaactggagagtatatatccttctactggatcgcagat
tatggagggatcggaaagagggctgatggaaactactttataaggataagagcaaagcca
ggaggatggtataaaccagaggaaataaaagaaattttaaatattgcagaagaatacgga
gcaaaaataaaaataactgatagaggagcatatgaaattcatggaattagtggattcgat
gcggaagatattgttttaagattgagagggaagggattattaactggttcggaggggcca
ttagttagagcaacgttggcatgtcccggaggaggaaattgtagtagtggattgataaac
acaacggaattggctaatttaatagaagataaatttaaagagagacctgctccatacaag
tttaaaattgcaattagcggatgtccaaactgctgtgttagacctcaaattcacgatgta
ggaattgttggtgtcaaatatccgaaagtaaatgaggaaaactgcaacggttgtggaaga
tgtgctgaggtttgtaagattgaagcgatagatataagaggagagatgtcttacacaaac
tacaatgtatgtattggttgtggaaagtgtattaaaaactgtccaaatgaggcaagagaa
gttaaagaagagggctatttagtttatgttggaggtaagacaggaagagaagttgttaaa
ggaattaaaatgaagttgatgagtgttgaggagatactaaactttattgataaagtgtta
gttgtctatggtaaatatgctgaaaaaccacaaagagaaaggttatcggcagttatgaaa
agagttggatacgaaaaattcttagaggatgttagaaaattaatgaaggagtaa

DBGET integrated database retrieval system