KEGG   Methanocaldococcus vulcanius: Metvu_0754Help
Entry
Metvu_0754        CDS       T01105                                 

Definition
nitrite and sulfite reductase 4Fe-4S region
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Metvu_0754
Enzymes [BR:mvu01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.98  With other, known, acceptors
    1.12.98.1  coenzyme F420 hydrogenase
     Metvu_0754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(718182..720035)
Genome map
AA seq 617 aa AA seqDB search
MYEWKLNEIVDGNMCARCGTCTVVCPNNLLTFEDRPKLKDECLRKGNGMCFEVCPRVSSG
KYQIKIRENFFEKYYYGKSEIEGQDGGVVTAFLKYLLENGKIDGAIVVGDECWKPISMAV
QNADDLLKSTKSKYAVSTLDALRKAGEMGLEKVAVVGLPCQINGLRKLQYFPYLAKHDFE
LGRDGKPVKLPKIEYLIGLFCMEKFKYDNMKEVLERHGIKIEDVKKFDIKKGKLIVYLEN
DKKEIKLEEFEVCSGCNICRDFDAGMADVSVGCVGSPDGYSTIIIRTKKGEEIKNAIELK
EGVDVEAINKLRNKKLKRFKKEVERRKETGEYISFYWIADYGGIGKRADGNYFIRIRAKP
GGWYKPEEIKEILNIAEEYGAKIKITDRGAYEIHGISGFDAEDIVLRLRGKGLLTGSEGP
LVRATLACPGGGNCSSGLINTTELANLIEDKFKERPAPYKFKIAISGCPNCCVRPQIHDV
GIVGVKYPKVNEENCNGCGRCAEVCKIEAIDIRGEMSYTNYNVCIGCGKCIKNCPNEARE
VKEEGYLVYVGGKTGREVVKGIKMKLMSVEEILNFIDKVLVVYGKYAEKPQRERLSAVMK
RVGYEKFLEDVRKLMKE
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatggaagttgaacgaaattgtagatggtaatatgtgtgcaagatgtggaact
tgcacggttgtatgtccaaataacctattaacatttgaagatagaccaaaattaaaagat
gagtgtttgagaaaaggaaatgggatgtgttttgaagtttgtccgagagtttcatctgga
aaatatcaaataaaaataagagaaaacttttttgaaaaatactattatggaaagagtgag
attgaaggacaggatggtggagttgttactgcctttttaaaatacctcttagaaaatggg
aagatagatggagccatagttgttggggatgaatgctggaaaccaatctcaatggctgtc
caaaatgcagatgacttattaaaatctacaaaatcaaaatatgctgtctcaacgttagat
gctttgaggaaagcaggagaaatggggttagaaaaagttgctgttgttggtttgccatgt
caaattaacggtttaaggaagttgcagtatttcccatacttggcaaaacatgattttgaa
cttggaagagatggaaagcccgtaaagctacctaagatagagtatttaattggattattc
tgtatggaaaaattcaaatatgacaatatgaaagaggtcttggaaagacatggaataaaa
attgaagatgttaaaaaatttgacattaaaaaaggaaaacttattgtttacttagaaaat
gataaaaaagaaattaaattagaggaatttgaggtctgttctggatgtaatatatgtagg
gactttgatgcaggaatggcagatgtttcagttggatgtgttggaagtccagatggttat
tcaacaatcataataagaactaaaaagggagaagaaattaaaaatgccattgaattaaaa
gaaggtgttgatgtagaggcaattaataaattaaggaataaaaaattaaagagatttaaa
aaagaagttgaaagaagaaaagaaactggagagtatatatccttctactggatcgcagat
tatggagggatcggaaagagggctgatggaaactactttataaggataagagcaaagcca
ggaggatggtataaaccagaggaaataaaagaaattttaaatattgcagaagaatacgga
gcaaaaataaaaataactgatagaggagcatatgaaattcatggaattagtggattcgat
gcggaagatattgttttaagattgagagggaagggattattaactggttcggaggggcca
ttagttagagcaacgttggcatgtcccggaggaggaaattgtagtagtggattgataaac
acaacggaattggctaatttaatagaagataaatttaaagagagacctgctccatacaag
tttaaaattgcaattagcggatgtccaaactgctgtgttagacctcaaattcacgatgta
ggaattgttggtgtcaaatatccgaaagtaaatgaggaaaactgcaacggttgtggaaga
tgtgctgaggtttgtaagattgaagcgatagatataagaggagagatgtcttacacaaac
tacaatgtatgtattggttgtggaaagtgtattaaaaactgtccaaatgaggcaagagaa
gttaaagaagagggctatttagtttatgttggaggtaagacaggaagagaagttgttaaa
ggaattaaaatgaagttgatgagtgttgaggagatactaaactttattgataaagtgtta
gttgtctatggtaaatatgctgaaaaaccacaaagagaaaggttatcggcagttatgaaa
agagttggatacgaaaaattcttagaggatgttagaaaattaatgaaggagtaa

DBGET integrated database retrieval system