KEGG   Methanocaldococcus vulcanius: Metvu_0897Help
Entry
Metvu_0897        CDS       T01105                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metvu_0897
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metvu_0897
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Metvu_0897
Enzymes [BR:mvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Metvu_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(878673..879878)
Genome map
AA seq 401 aa AA seqDB search
MKKYKEKYPDKNGKFGIYGGKFVPETLMPAITELEEAFNRFWINNEGNFREEFYALLRDY
VGRPTPLYYAERFSEELGCKVYLKREDLAHLGAHKINNALGQALLAKKMGKKRVIAETGA
GQHGVATAAACAKLGLECIVYMGAKDVERQKLNVFRMELMGAKVIPVFGGSQTLKDAVNE
ALRDWTTNVRTTYYLLGSALGPHPYPMMVREFQRVIGKEIKEQILEKEGRLPDVIVACVG
GGSNAIGAFYEFLDDDVELYAVEAGGKGVETGMHGASLCAGEVGVLHGSKIYVKEDEFGQ
IEESYSISAGLDYPGVGPELSFLKDEGRINAVYITDDEALEAFQLLCRLEGILPALESSH
ALAYAVKLADKLDKDDIMVINLSGRGDKDVHTVAKALGREI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaatataaagagaaatatcctgataaaaatgggaaatttggaatttatggaggt
aaattcgttccggagacattaatgcctgcaataactgaattagaagaggcctttaataga
ttttggataaacaatgaaggaaattttagagaagagttttacgctttacttagggactat
gttggaagacctacgcctctttactatgctgaaagattcagtgaagaactgggatgcaag
gtctatttaaaaagagaggacttagcccacttaggggcccataaaataaacaatgcactc
ggacaggcactattggcaaaaaaaatgggaaaaaagagagtaatagcagaaacaggggca
ggacagcacggagtagcaacagcagcggcatgtgcaaaacttgggctggaatgtatagta
tatatgggagcaaaagacgttgaaaggcagaaattaaatgtttttaggatggaactaatg
ggagcgaaagtaattcctgtttttggaggatctcagacattaaaagatgcagtaaatgaa
gcattaagggactggacaaccaacgttagaaccacctattacctacttggatctgctctt
ggcccacatccatatccaatgatggtaagagagttccagagagttattggaaaggaaatt
aaagagcagatattagaaaaagaaggaaggttgcctgatgttatagttgcatgtgttgga
ggaggaagtaatgccatcggagcattttatgaatttttagatgatgatgttgaattatac
gctgttgaagcaggtggaaaaggagtagaaacaggaatgcatggcgcttcactttgtgct
ggagaggttggagttctacatggatcaaaaatatatgttaaagaagatgagttcgggcag
atagaagaaagttatagtatttcagctggtttagattatcctggcgtaggacctgaactt
tcatttttaaaagatgaaggaaggataaacgctgtctacataaccgatgatgaagcatta
gaagcatttcaacttctttgtagattggaaggtattttacctgcattagaaagttcccat
gcattggcttatgctgttaaattagccgataagttagataaggatgatataatggttatt
aacttgtctggaaggggagataaggatgttcatacggttgctaaggcattgggtagagag
atttaa

DBGET integrated database retrieval system