KEGG   Methanocaldococcus vulcanius: Metvu_0912Help
Entry
Metvu_0912        CDS       T01105                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Metvu_0912
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metvu_0912
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metvu_0912
Enzymes [BR:mvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metvu_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
893865..895082
Genome map
AA seq 405 aa AA seqDB search
MLQKCIKCGKTYDVDEIIYTCECGGLLEIVYDYEEIKNKISKETLRKRQIGVWRYLEYLP
VKDERKIVTLFEGGTPLYRCKNLEKELGVKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQINGNFD
DALEMVKQLAREKLIYLLNSINPFRLEGQKTIGFEICDQLNWQVPDRVIVPVGNAGNISA
IWKGFREFEATGIIDELPKMTGIQAEGAKPIVEAFKRKAKDITPYKNPETIATAIRIGNP
VNAPKALEAIYSSGGYAEAVSDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLDEGIV
DRDERIVCITTGHGLKDPDAAIRASEEPIKIECDIDVLKKILKED
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaaaatgtataaaatgtggaaaaacttacgatgttgatgaaataatctacacc
tgcgagtgtggcgggttgttagaaatagtttatgattatgaagagataaaaaacaaaatt
tcaaaagaaacattgagaaaaagacagattggtgtttggagatatttagagtatcttcca
gtaaaagatgaaagaaaaatagttacactatttgaaggaggaacccccctatatagatgc
aaaaacttagagaaagagcttggagttaaagaactctatgtaaaaaacgaaggagcaaat
ccaacagggagctttaaagataggggtatgactgttggtgttacaagggcaaacgagtta
ggagttgaagtagttggctgtgcgtcaacaggaaacacatctgcttcattagcagcttac
tcagcaagaagtggaaagaaatgtattgttttactgccagagggaaaagttgccttggga
aaattagctcaggcaatgttttacggggctaaggttatacagattaatggaaactttgac
gatgcgttggagatggttaagcagttagcaagagaaaaattaatttatttattaaattca
ataaatccatttaggttggaaggtcagaaaactatcggctttgagatctgcgatcaacta
aattggcaagttccagatagagttatcgttccagtaggaaatgcaggaaacataagtgca
atatggaaaggatttagggagtttgaagcaacagggattattgatgagttgccaaaaatg
acaggaattcaggcagagggtgctaagccgattgttgaagcatttaagagaaaagcgaaa
gacataacaccttacaaaaaccccgagacgattgcaacagctataagaattggaaatcct
gttaatgctccaaaggcgttggaggcaatatactcatctggcggctatgctgaggcagtt
agcgatgaggagatcgtagaagcacaaaaattattagcaaggaaagagggaatttttgtt
gaaccggcctctgcctcatcaatagcaggccttaagaagttattagatgagggaattgtt
gatagagatgaaaggatcgtatgtataaccactgggcatgggttgaaagaccctgatgct
gcaataagagcaagtgaagagccgataaagattgaatgcgatatagatgtcttaaaaaag
atattgaaagaagattaa

DBGET integrated database retrieval system