KEGG   Methanocaldococcus vulcanius: Metvu_0912Help
Entry
Metvu_0912        CDS       T01105                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00260  Glycine, serine and threonine metabolism
mvu00750  Vitamin B6 metabolism
mvu01100  Metabolic pathways
mvu01110  Biosynthesis of secondary metabolites
mvu01120  Microbial metabolism in diverse environments
mvu01230  Biosynthesis of amino acids
Module
mvu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Metvu_0912
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Metvu_0912
Enzymes [BR:mvu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Metvu_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACX72770
JGI: Metvu_0912
UniProt: C9RGR8
Position
893865..895082
Genome map
AA seq 405 aa AA seqDB search
MLQKCIKCGKTYDVDEIIYTCECGGLLEIVYDYEEIKNKISKETLRKRQIGVWRYLEYLP
VKDERKIVTLFEGGTPLYRCKNLEKELGVKELYVKNEGANPTGSFKDRGMTVGVTRANEL
GVEVVGCASTGNTSASLAAYSARSGKKCIVLLPEGKVALGKLAQAMFYGAKVIQINGNFD
DALEMVKQLAREKLIYLLNSINPFRLEGQKTIGFEICDQLNWQVPDRVIVPVGNAGNISA
IWKGFREFEATGIIDELPKMTGIQAEGAKPIVEAFKRKAKDITPYKNPETIATAIRIGNP
VNAPKALEAIYSSGGYAEAVSDEEIVEAQKLLARKEGIFVEPASASSIAGLKKLLDEGIV
DRDERIVCITTGHGLKDPDAAIRASEEPIKIECDIDVLKKILKED
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgctacaaaaatgtataaaatgtggaaaaacttacgatgttgatgaaataatctacacc
tgcgagtgtggcgggttgttagaaatagtttatgattatgaagagataaaaaacaaaatt
tcaaaagaaacattgagaaaaagacagattggtgtttggagatatttagagtatcttcca
gtaaaagatgaaagaaaaatagttacactatttgaaggaggaacccccctatatagatgc
aaaaacttagagaaagagcttggagttaaagaactctatgtaaaaaacgaaggagcaaat
ccaacagggagctttaaagataggggtatgactgttggtgttacaagggcaaacgagtta
ggagttgaagtagttggctgtgcgtcaacaggaaacacatctgcttcattagcagcttac
tcagcaagaagtggaaagaaatgtattgttttactgccagagggaaaagttgccttggga
aaattagctcaggcaatgttttacggggctaaggttatacagattaatggaaactttgac
gatgcgttggagatggttaagcagttagcaagagaaaaattaatttatttattaaattca
ataaatccatttaggttggaaggtcagaaaactatcggctttgagatctgcgatcaacta
aattggcaagttccagatagagttatcgttccagtaggaaatgcaggaaacataagtgca
atatggaaaggatttagggagtttgaagcaacagggattattgatgagttgccaaaaatg
acaggaattcaggcagagggtgctaagccgattgttgaagcatttaagagaaaagcgaaa
gacataacaccttacaaaaaccccgagacgattgcaacagctataagaattggaaatcct
gttaatgctccaaaggcgttggaggcaatatactcatctggcggctatgctgaggcagtt
agcgatgaggagatcgtagaagcacaaaaattattagcaaggaaagagggaatttttgtt
gaaccggcctctgcctcatcaatagcaggccttaagaagttattagatgagggaattgtt
gatagagatgaaaggatcgtatgtataaccactgggcatgggttgaaagaccctgatgct
gcaataagagcaagtgaagagccgataaagattgaatgcgatatagatgtcttaaaaaag
atattgaaagaagattaa

DBGET integrated database retrieval system