KEGG   Methanocaldococcus vulcanius: Metvu_0965Help
Entry
Metvu_0965        CDS       T01105                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mvu  Methanocaldococcus vulcanius
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
946587..948197
Genome map
AA seq 536 aa AA seqDB search
MDEKTKLMRCIIEKILDEHKKGKTLDKKRIEQIKAECLRLHRIGIGHPSNSEILQYATEE
EKKILIPILRKKPVRTISGVAVVAVMTSPEKCPHGKCIFCPGGVKSVFGDVPQSYTGREP
ATMRGLMFNFDPYLQTKARIEQLEKVGHPTNKIELIIMGGTFPARDIVYQDWFIKRCLDA
MNEIDSSSLEEAQKINETAEHRCVALCIETRPDCCGKEEINQMLKLGTTRVELGAQTIYN
EILELCKRGHTVEDTIKATQLLKDSGLKVSYHLMPGMPGSDRDMDKKMFKEIFNNPDFKP
DMVKIYPCLVIEGTELYELWKEGLYKPYREEEAIEIISYAKSIMPKWVRTSRIQRDIPAT
VIVDGVKKSNLGELVYKYMEKKGIKCRCIRCREVGHVMYKKGIMPDIEHIKLCREEYEAS
GGTEIFLSYEDVKNDILIAFLRLRDPYKPFRKEIDDNTMLVRQLHVCGQEKPLTKDLKEI
TWQHKGYGRKLLEEAERIAKEEFGKKKILITSGIGVRNYYRKLGYEKIGVYMGKTL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaaaccaaactaatgagatgcattattgaaaaaattttagatgaacataaa
aaagggaaaacacttgataaaaagagaattgaacaaattaaagcagagtgtttgcgactt
catagaattggtatagggcatccttcaaactctgaaattttgcagtatgcaacagaagaa
gaaaaaaagatattaattccaatattaagaaaaaagccagttagaactatatctggcgta
gctgttgttgctgttatgacatccccagaaaaatgccctcatggaaaatgtatattctgc
cccggaggagttaaaagcgtatttggagatgtgccacaaagctacactggaagagagcca
gctacaatgaggggcttaatgttcaacttcgatccatatctacaaacaaaggcaagaatt
gagcagttggaaaaggtagggcatccaacaaataaaatcgaattaattataatgggagga
acgtttccagcaagagatatcgtctatcaggactggtttatcaagagatgcttagatgct
atgaatgaaattgattcaagtagtttagaggaagcacaaaaaattaatgaaacagcagaa
catagatgtgttgccctctgcatagaaacaagacctgactgctgtggaaaggaagagata
aatcagatgttgaaattaggaactacaagagttgagttaggggctcaaaccatatacaac
gagatcttagagttatgtaaaagaggacatacagttgaagatacaataaaagcaacccaa
ttattaaaagatagtggtttaaaggtatcttatcatttaatgcctggaatgcctggctca
gatagggatatggataaaaagatgtttaaagaaatattcaacaacccagatttcaagccg
gatatggttaaaatctatccatgcttagttattgaaggaactgaactttatgagttgtgg
aaggaagggctttacaaaccatacagagaggaagaggcaatagagataattagttatgca
aaatcaataatgccgaaatgggttagaacttcaagaattcagagagatattcctgcaacg
gttatagttgatggagttaagaagagtaatttgggagagttggtttataaatatatggaa
aagaaggggatcaagtgtagatgtataaggtgtagagaagttgggcatgttatgtataaa
aaaggaataatgccagatattgagcatataaaactatgcagggaggagtatgaagcaagt
ggtgggactgagatatttttatcatacgaagatgtaaagaatgatattttaattgcattt
ttaagattgagagatccatataaaccatttaggaaagagattgatgataatacgatgtta
gttaggcaattacatgtttgcggacaagaaaaaccattaactaaggatttaaaggaaata
acttggcaacataagggatatggaagaaaacttttagaagaggcagagagaatagcaaag
gaggaatttggaaagaaaaaaatattaattaccagtggaataggggtaagaaattactat
cgaaagttaggttatgaaaaaattggagtttatatgggaaaaactctttaa

DBGET integrated database retrieval system