KEGG   Methanocaldococcus vulcanius: Metvu_0989Help
Entry
Metvu_0989        CDS       T01105                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mvu  Methanocaldococcus vulcanius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(974667..975719)
Genome map
AA seq 350 aa AA seqDB search
MSVVEYLKKLSRCHGISGREDNVREVMKKELEKYCDSIEIDKFGNLIAKRGNSGKKIMIA
AHMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVVVHGNKGDIIGVLGSKPPHKMKE
EERNKLIKYEDMFIDIGAESRDEAIEMGVEIGSWVSFLSEVYELGKNRLTGKAFDDRVGC
AVLLEVMKRLSEEEIDCQVYAVGTVQEEVGLKGAKVSAFKINPDVAIALDVTIAGDHPGI
KKEDAPVDLGKGAVVGIVDASGRGLIAHPKVLEMVKFVAKEYNIEVQWEVGEGGTTDATA
IHLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVYQCIKNVNKFF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgttgaatatttaaaaaaactttcgagatgtcatggaatatctgggagagaa
gataatgttagggaagttatgaaaaaagaattggagaaatattgtgattctattgaaata
gataaatttggaaatttaattgctaagagaggaaatagtgggaaaaaaattatgatagca
gcacatatggatgagattggattgatggttaaatatatcgatgataatggatttttaaag
tttacaaagatcggaggaatttatgacccaacaatattaaatcagaaagttgttgttcat
gggaataagggagatataataggggttctcggatctaaacctcctcataaaatgaaagaa
gaggaaagaaacaaacttataaaatatgaggacatgtttattgatattggagcagagagt
agagatgaagcaatagaaatgggcgttgagataggaagctgggtttcttttttaagtgag
gtatatgagttgggaaaaaataggttaacaggaaaagcatttgatgacagagttggctgc
gctgttctcttggaggttatgaaaagattgtcagaagaggagattgattgccaagtttat
gctgtgggaactgttcaagaggaggttggattaaaaggagcgaaggtttctgcttttaaa
ataaatccagatgttgcgatcgctcttgatgttacaattgcaggtgatcaccccggaatt
aaaaaagaagatgccccagtagatttgggtaaaggagctgttgtaggaatagttgatgct
tcgggaagggggttaattgctcatcctaaggttttggagatggttaaatttgttgcaaag
gaatataacattgaagttcagtgggaagttggagaagggggaacaactgatgctactgcg
attcatttaacaagagaaggaattccaacaggagttatttcagttccagcgagatatatc
cacacacctgttgaggttattgataaaagggacttagaaaaaactgttgaactggtttat
caatgcataaaaaacgttaataagtttttctaa

DBGET integrated database retrieval system