KEGG   Methanocaldococcus vulcanius: Metvu_1158Help
Entry
Metvu_1158        CDS       T01105                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metvu_1158
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_1158
   00020 Citrate cycle (TCA cycle)
    Metvu_1158
   00620 Pyruvate metabolism
    Metvu_1158
   00640 Propanoate metabolism
    Metvu_1158
   00650 Butanoate metabolism
    Metvu_1158
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metvu_1158
   00680 Methane metabolism
    Metvu_1158
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metvu_1158
Enzymes [BR:mvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metvu_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1137316..1137576
Genome map
AA seq 86 aa AA seqDB search
MVTIAAIIYEPGNSIRNKTGTWRTFKPILDVEKCVKCENCYIFCPEGAIQEDENGNFKID
YDYCKGCLICMNECPVNAITKVREEK
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggttaccattgctgcgataatatacgagccgggaaattcaataaggaacaagacagga
acctggagaacttttaagccaatattagatgttgaaaaatgtgtaaaatgtgaaaattgc
tatattttctgcccggaaggggctattcaagaagatgaaaatggaaacttcaaaatagat
tacgactactgcaaaggttgccttatatgtatgaatgaatgtcctgtaaatgcaataacc
aaagttagagaagaaaaataa

DBGET integrated database retrieval system