KEGG   Methanocaldococcus vulcanius: Metvu_1159Help
Entry
Metvu_1159        CDS       T01105                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metvu_1159
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_1159
   00020 Citrate cycle (TCA cycle)
    Metvu_1159
   00620 Pyruvate metabolism
    Metvu_1159
   00640 Propanoate metabolism
    Metvu_1159
   00650 Butanoate metabolism
    Metvu_1159
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metvu_1159
   00680 Methane metabolism
    Metvu_1159
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Metvu_1159
Enzymes [BR:mvu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Metvu_1159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1137828..1138988
Genome map
AA seq 386 aa AA seqDB search
MCEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLAEFVANGELDAEYIKVESEH
SAMSACIGAAATGARTFTATASQGLALMHEMLFIASGMRLPIVMMVANRALSAPINIWND
HQDSIAERDTGWIQIYAEDNQETLDSIIQAYKIAENENVLLPVMVCLDGFILTHTVEPVI
IPKAERVRDFLGVYEPKHAYLDPDRPITQGPVGVPDCYMETRKQLEDAIERSKRVIKDVN
AEFAELFNRKYGNGLVEAYNLDNADTVLVAMGTVCGTIKYVIDQLKKEGKNVGLLRIRTF
RPFPKEDIKDLLKEVDNIAVLDKNVSFGFNKGALGIEMSSILKNKKVCNYIVGLGGRDIK
IEDIKKIISHVEKAEDDETMWIGLKE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagttaaggtcatcacaggaacttccgcagctgccgaagctgcaaaattggca
gatgtcgatgtcattgcagcgtatcctataactccacaaacaacgtgtgttgaaaaattg
gctgagtttgtagccaatggcgagttagatgccgaatacataaaggttgaaagtgaacat
tcagcaatgtctgcctgtattggagctgctgcaacaggagcaaggacatttacagcaact
gcttcacaaggtttagctttaatgcatgaaatgctgtttatagcttcaggaatgcgacta
ccaatagttatgatggttgctaacagggctttatcagctcctataaacatatggaatgat
catcaggattcaatagctgagagagatactggatggatccaaatatatgcagaggataat
caagaaacactcgatagtataattcaggcctacaaaatagctgaaaatgaaaatgtttta
cttccggttatggtctgtttagatggtttcatattaacccacacagttgaaccagttata
attccaaaagcagagagagttagggatttcttaggtgtttacgagccaaagcatgcatat
ttagatccagatcggccaataactcaagggcctgtaggagtgccagattgttatatggag
acgagaaaacagttagaggatgcaatagaaagatctaaaagagttattaaagatgtaaat
gcagaattcgcagaattgtttaacagaaagtatggaaacggattggttgaagcatacaat
ttggataatgcagatactgttttggtggcaatgggaaccgtctgtggaactataaagtat
gtcattgatcaactcaaaaaagaagggaaaaatgttggactattgagaataagaacattc
agaccatttccaaaagaagatataaaggatctgttaaaagaagtagataacattgcagtt
ttagataaaaacgtatcatttggatttaataaaggagcgttaggaatagagatgtcatca
attttaaagaataaaaaagtttgtaattatattgttggtttgggaggaagggacataaaa
atagaagatataaagaaaataatcagccatgttgaaaaagcagaggacgatgaaacaatg
tggataggattaaaggaataa

DBGET integrated database retrieval system