KEGG   Methanocaldococcus vulcanius: Metvu_1410Help
Entry
Metvu_1410        CDS       T01105                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mvu00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mvu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mvu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mvu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1415036..1415890)
Genome map
AA seq 284 aa AA seqDB search
MVKKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVDVGIKDILFITGKGKQ
AIENHFDVNYELECKLEKSGKLDLLKIIKEIDNLGNIFYVRQKEQKGLGDAVLYGEEFVG
DEYFIAMVGDTIYSKNIVKDLIKVHKKYGCSVIALERVPMEDVHKYGVIDGEEVEEGIYK
INNMVEKPNIEEAPSNLIITGAYLLSPKIFEKIKETPVGRGGEVQITDAMNLLLKEEDIL
GVEISCKRYDIGDVFGWLKANVEIGVEKFPEFREFLKNFVEKLE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaagcggtaattccagtagcgggttttggaactcgtctccttcccataaca
aaagcacaaccaaaagaaatgcttccagtagttaacaagccaatagttcagtatgttgtt
gaagatttagtcgatgtaggcataaaagatatactctttatcactggaaaaggaaaacag
gcaatagaaaaccatttcgacgtaaattatgaattagaatgtaaattggaaaaatcaggg
aagttagatcttctcaaaattattaaagagatagataatttgggaaatattttctatgtc
agacagaaagaacagaaaggtttaggggatgctgttttatacggagaagagttcgttgga
gatgaatactttatagcaatggtgggagatacaatctattcaaaaaatattgtaaaagac
ctaataaaagttcataaaaaatatggatgttctgttattgctttggaaagagttccaatg
gaagatgtgcacaagtatggagtaatagatggagaagaagtagaagaggggatttacaaa
ataaataatatggttgaaaaaccaaacatcgaagaagccccatctaacttaattataaca
ggagcttatctgttatccccgaaaatatttgaaaaaattaaagaaacgcctgtcggtagg
ggaggagaagtgcaaataactgatgcaatgaatctacttttaaaagaggaagatatttta
ggagtggagattagttgtaaaagatacgatattggagatgtttttggatggttaaaggca
aatgtggaaattggagtagagaaatttccagaatttagagaatttttgaaaaatttcgtt
gaaaaattagagtaa

DBGET integrated database retrieval system