KEGG   Methanocaldococcus vulcanius: Metvu_1410Help
Entry
Metvu_1410        CDS       T01105                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Metvu_1410
   00052 Galactose metabolism
    Metvu_1410
   00500 Starch and sucrose metabolism
    Metvu_1410
   00520 Amino sugar and nucleotide sugar metabolism
    Metvu_1410
Enzymes [BR:mvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Metvu_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1415036..1415890)
Genome map
AA seq 284 aa AA seqDB search
MVKKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVDVGIKDILFITGKGKQ
AIENHFDVNYELECKLEKSGKLDLLKIIKEIDNLGNIFYVRQKEQKGLGDAVLYGEEFVG
DEYFIAMVGDTIYSKNIVKDLIKVHKKYGCSVIALERVPMEDVHKYGVIDGEEVEEGIYK
INNMVEKPNIEEAPSNLIITGAYLLSPKIFEKIKETPVGRGGEVQITDAMNLLLKEEDIL
GVEISCKRYDIGDVFGWLKANVEIGVEKFPEFREFLKNFVEKLE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaagcggtaattccagtagcgggttttggaactcgtctccttcccataaca
aaagcacaaccaaaagaaatgcttccagtagttaacaagccaatagttcagtatgttgtt
gaagatttagtcgatgtaggcataaaagatatactctttatcactggaaaaggaaaacag
gcaatagaaaaccatttcgacgtaaattatgaattagaatgtaaattggaaaaatcaggg
aagttagatcttctcaaaattattaaagagatagataatttgggaaatattttctatgtc
agacagaaagaacagaaaggtttaggggatgctgttttatacggagaagagttcgttgga
gatgaatactttatagcaatggtgggagatacaatctattcaaaaaatattgtaaaagac
ctaataaaagttcataaaaaatatggatgttctgttattgctttggaaagagttccaatg
gaagatgtgcacaagtatggagtaatagatggagaagaagtagaagaggggatttacaaa
ataaataatatggttgaaaaaccaaacatcgaagaagccccatctaacttaattataaca
ggagcttatctgttatccccgaaaatatttgaaaaaattaaagaaacgcctgtcggtagg
ggaggagaagtgcaaataactgatgcaatgaatctacttttaaaagaggaagatatttta
ggagtggagattagttgtaaaagatacgatattggagatgtttttggatggttaaaggca
aatgtggaaattggagtagagaaatttccagaatttagagaatttttgaaaaatttcgtt
gaaaaattagagtaa

DBGET integrated database retrieval system