KEGG   Methanocaldococcus vulcanius: Metvu_1599Help
Entry
Metvu_1599        CDS       T01105                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metvu_1599
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metvu_1599
   00640 Propanoate metabolism
    Metvu_1599
   00660 C5-Branched dibasic acid metabolism
    Metvu_1599
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metvu_1599
Enzymes [BR:mvu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metvu_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1608517..1609611
Genome map
AA seq 364 aa AA seqDB search
MKLHEYEAKNIFKKYGIPVPESFLISKEDDLNSINIDKEVVLKAQVLVGGRGKAGGILFA
SNKGEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIIDRDAKKPVIIFSTEGG
VDIEEVAEKNPEKIIKYYIDIKKPFLPYITRWIVKDAKLPSNEIGKVADVIYKLYKIFKE
LDATMVEINPLVITKNGDVYAADAVLHLDDDASFKHNYEGFEEYKNKEKLPFAYVELEGD
VAVIGNGAGLTLASMDIINNLGRKPACFLDIGGGAEAETVKLALKKVLENKNVKGIFINI
LGGITRCDEVAKGIVDVLKEHPNIKFAVRMMGTNEEIGRKILEEHGIPYETSMEEAGRKL
IENL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacacgaatatgaggcaaaaaacatatttaaaaagtatggtatcccggtgcct
gaaagctttttaatatctaaggaagatgatttaaacagtataaatattgataaagaagtt
gttttaaaagctcaggttttagttggaggaagaggaaaagcaggagggattttatttgca
tcaaacaagggagagtttataaagaaggcggaagaactattcaataaagaagttaaagga
gaaaaagttgaaaaaatcttagttgaagaaaaattgccaatagaaaaagaatattatgtt
tcaatcattatagacagagatgctaaaaagccagtaattattttctcaactgaaggggga
gtagatattgaagaagtcgctgaaaagaatccagagaagattataaaatactacatagat
attaaaaagccatttcttccatatataacaagatggatagttaaagatgcaaaactgcca
agtaatgagattggaaaagtcgctgatgttatttataaattatacaaaatctttaaagag
ttggatgccacaatggttgaaatcaacccattagttataacgaaaaatggagatgtctat
gccgctgatgccgttcttcacttagatgatgatgcatcatttaaacataattatgagggt
tttgaagaatataaaaataaagaaaaattgccatttgcctacgttgagttggagggagat
gtggcagttataggtaatggggctggcttaacattggcaagtatggatattataaataac
ctcggcagaaaaccagcttgcttcttagatattggaggaggagctgaggcagaaacagta
aaattagctttgaaaaaagttttagaaaataaaaatgttaagggaatatttatcaatatt
ttaggaggaataacaaggtgtgatgaagttgccaaaggaattgttgatgtcttaaaggag
catccaaatataaagtttgctgttagaatgatgggaactaacgaagagatcggaaggaaa
attttggaggagcatggcatcccttacgaaacatcaatggaagaagcaggaagaaaattg
attgaaaacctataa

DBGET integrated database retrieval system