KEGG   Methanocaldococcus vulcanius: Metvu_1599Help
Entry
Metvu_1599        CDS       T01105                                 

Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metvu_1599
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Metvu_1599
   00640 Propanoate metabolism
    Metvu_1599
   00660 C5-Branched dibasic acid metabolism
    Metvu_1599
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Metvu_1599
Enzymes [BR:mvu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Metvu_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1608517..1609611
Genome map
AA seq 364 aa AA seqDB search
MKLHEYEAKNIFKKYGIPVPESFLISKEDDLNSINIDKEVVLKAQVLVGGRGKAGGILFA
SNKGEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIIDRDAKKPVIIFSTEGG
VDIEEVAEKNPEKIIKYYIDIKKPFLPYITRWIVKDAKLPSNEIGKVADVIYKLYKIFKE
LDATMVEINPLVITKNGDVYAADAVLHLDDDASFKHNYEGFEEYKNKEKLPFAYVELEGD
VAVIGNGAGLTLASMDIINNLGRKPACFLDIGGGAEAETVKLALKKVLENKNVKGIFINI
LGGITRCDEVAKGIVDVLKEHPNIKFAVRMMGTNEEIGRKILEEHGIPYETSMEEAGRKL
IENL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacacgaatatgaggcaaaaaacatatttaaaaagtatggtatcccggtgcct
gaaagctttttaatatctaaggaagatgatttaaacagtataaatattgataaagaagtt
gttttaaaagctcaggttttagttggaggaagaggaaaagcaggagggattttatttgca
tcaaacaagggagagtttataaagaaggcggaagaactattcaataaagaagttaaagga
gaaaaagttgaaaaaatcttagttgaagaaaaattgccaatagaaaaagaatattatgtt
tcaatcattatagacagagatgctaaaaagccagtaattattttctcaactgaaggggga
gtagatattgaagaagtcgctgaaaagaatccagagaagattataaaatactacatagat
attaaaaagccatttcttccatatataacaagatggatagttaaagatgcaaaactgcca
agtaatgagattggaaaagtcgctgatgttatttataaattatacaaaatctttaaagag
ttggatgccacaatggttgaaatcaacccattagttataacgaaaaatggagatgtctat
gccgctgatgccgttcttcacttagatgatgatgcatcatttaaacataattatgagggt
tttgaagaatataaaaataaagaaaaattgccatttgcctacgttgagttggagggagat
gtggcagttataggtaatggggctggcttaacattggcaagtatggatattataaataac
ctcggcagaaaaccagcttgcttcttagatattggaggaggagctgaggcagaaacagta
aaattagctttgaaaaaagttttagaaaataaaaatgttaagggaatatttatcaatatt
ttaggaggaataacaaggtgtgatgaagttgccaaaggaattgttgatgtcttaaaggag
catccaaatataaagtttgctgttagaatgatgggaactaacgaagagatcggaaggaaa
attttggaggagcatggcatcccttacgaaacatcaatggaagaagcaggaagaaaattg
attgaaaacctataa

DBGET integrated database retrieval system