KEGG   Methanocaldococcus vulcanius: Metvu_1713Help
Entry
Metvu_1713        CDS       T01105                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00010  Glycolysis / Gluconeogenesis
mvu00051  Fructose and mannose metabolism
mvu00562  Inositol phosphate metabolism
mvu01100  Metabolic pathways
mvu01110  Biosynthesis of secondary metabolites
mvu01120  Microbial metabolism in diverse environments
mvu01130  Biosynthesis of antibiotics
mvu01200  Carbon metabolism
mvu01230  Biosynthesis of amino acids
Module
mvu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mvu_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_1713
   00051 Fructose and mannose metabolism
    Metvu_1713
   00562 Inositol phosphate metabolism
    Metvu_1713
Enzymes [BR:mvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metvu_1713
Exosome [BR:mvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metvu_1713
  Exosomal proteins of bladder cancer cells
   Metvu_1713
  Exosomal proteins of melanoma cells
   Metvu_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM NMO FMN_dh ThiG His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: ACX73565
JGI: Metvu_1713
UniProt: C9RE36
Position
complement(1711215..1711874)
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYAESIGKKGLEIAKIAEKISEESGIVIGVAPQFVDLRSIVESVEIPVYSQH
IDNISPGSHTGHILPEAVKDCGCTGTLINHSERRMLLADIEAVINKCKNLELETIVCTNN
VNTSKAVSTLSPDYIAVEPPELIGTGIPVSKANPEIVEGTVRAVKEINKDVKVLCGAGIS
KGEDVKAALDLGAEGVLLASGVVKAKNVEEAIRELIKYL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcgttattaactacaagacatacgcagagagtattggaaagaaagggttagaa
atagcaaaaattgcagaaaaaataagtgaagaaagcggaattgtaataggggtagcacct
caatttgttgatctaaggtcgatagttgaaagtgtagagattcctgtatactcgcaacat
attgataatatctctccgggaagtcatacaggacatatacttccagaagcagttaaagat
tgcggttgcacagggactttaataaatcactcagagagaaggatgttattggcagatatt
gaagcagttataaacaaatgcaaaaatctggaattagaaacaatcgtttgcactaacaat
gtaaatacatccaaggcagtttcaactttaagtcctgattatattgctgtggaacctcca
gagcttataggaactggaattcctgtttcaaaggcaaatcctgaaattgtagagggaaca
gttagggcagttaaagagataaataaagatgttaaagtgctctgtggagctggaatatcc
aaaggagaagatgttaaagctgctctggatttaggagcagagggtgttttattggcctct
ggagtagttaaggcgaagaatgtagaggaggcaataagagagttaattaaatatctttaa

DBGET integrated database retrieval system