KEGG   Methanocaldococcus vulcanius: Metvu_1713Help
Entry
Metvu_1713        CDS       T01105                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Metvu_1713
   01230 Biosynthesis of amino acids
    Metvu_1713
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Metvu_1713
   00051 Fructose and mannose metabolism
    Metvu_1713
   00562 Inositol phosphate metabolism
    Metvu_1713
Enzymes [BR:mvu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Metvu_1713
Exosome [BR:mvu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Metvu_1713
  Exosomal proteins of bladder cancer cells
   Metvu_1713
  Exosomal proteins of melanoma cells
   Metvu_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1711215..1711874)
Genome map
AA seq 219 aa AA seqDB search
MLIVINYKTYAESIGKKGLEIAKIAEKISEESGIVIGVAPQFVDLRSIVESVEIPVYSQH
IDNISPGSHTGHILPEAVKDCGCTGTLINHSERRMLLADIEAVINKCKNLELETIVCTNN
VNTSKAVSTLSPDYIAVEPPELIGTGIPVSKANPEIVEGTVRAVKEINKDVKVLCGAGIS
KGEDVKAALDLGAEGVLLASGVVKAKNVEEAIRELIKYL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgttgatcgttattaactacaagacatacgcagagagtattggaaagaaagggttagaa
atagcaaaaattgcagaaaaaataagtgaagaaagcggaattgtaataggggtagcacct
caatttgttgatctaaggtcgatagttgaaagtgtagagattcctgtatactcgcaacat
attgataatatctctccgggaagtcatacaggacatatacttccagaagcagttaaagat
tgcggttgcacagggactttaataaatcactcagagagaaggatgttattggcagatatt
gaagcagttataaacaaatgcaaaaatctggaattagaaacaatcgtttgcactaacaat
gtaaatacatccaaggcagtttcaactttaagtcctgattatattgctgtggaacctcca
gagcttataggaactggaattcctgtttcaaaggcaaatcctgaaattgtagagggaaca
gttagggcagttaaagagataaataaagatgttaaagtgctctgtggagctggaatatcc
aaaggagaagatgttaaagctgctctggatttaggagcagagggtgttttattggcctct
ggagtagttaaggcgaagaatgtagaggaggcaataagagagttaattaaatatctttaa

DBGET integrated database retrieval system