KEGG   Methanocaldococcus vulcanius: Metvu_1727Help
Entry
Metvu_1727        CDS       T01105                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mvu  Methanocaldococcus vulcanius
Pathway
mvu00300  Lysine biosynthesis
mvu01100  Metabolic pathways
mvu01120  Microbial metabolism in diverse environments
mvu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mvu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Metvu_1727
Enzymes [BR:mvu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Metvu_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 LXG
Motif
Other DBs
NCBI-ProteinID: ACX73578
JGI: Metvu_1727
UniProt: C9RE49
Position
complement(1723544..1724785)
Genome map
AA seq 413 aa AA seqDB search
MDLTKEAIQLESDLIRINSVNPSFGGKGEKEKANYVKRKLIEYVNKYGITNYTLKDYTTI
DKYGIERPNIVFKLDFGKEKTLHIISHLDTVPEGDISLWETDPYKPVLKDGKIYGRGSED
NHKGIVSSLLLLKMIFESDNVKPKYNLSLIFVSDEEDGSEYGLKYLLNFENEIFKKDDLI
IVPDFGTPKGDFIEIGEKGILWIKFDIEGKQCHGSTPENGVNADVIAFNFANGLYKQLYE
KFDNVDEIFLPKYSTFEPTILKSGVENPNTIPGHVEVVFDCRILPTYSLEDVLKEIDNFI
KTFDFRGGLKYYDPSVEMQINYKILKEEQPNYTKKDSKVVLELKRAIKKVLNEDAKLCGM
GGGTVAAFLRFKGYEVAVWGIGEETAHQPNEHIRIDDLVKMAKVFYEIITPSD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggatctaacaaaagaagccatacaattagaaagcgatctgataaggataaactccgtc
aatccatcttttggaggaaaaggagaaaaagaaaaagcaaactatgttaaaagaaaatta
atagaatatgtaaacaaatatgggataacaaattacacgctgaaagattacacgacaata
gataaatacggcattgaaagaccaaatattgtattcaagttagattttggaaaagagaaa
acattacacattatctctcacttagatactgttccagaaggagatattagtttatgggaa
acagatccttataagcccgttcttaaagatggaaagatatatggaagaggtagtgaggac
aaccataagggaattgtctcctctttgttattattaaaaatgatctttgagagtgataat
gttaaaccaaaatacaacctatccttgatttttgtctctgatgaagaagatggtagcgag
tatggattaaaatatttgttaaactttgaaaatgagatatttaaaaaagatgacttgata
attgttcctgactttgggacaccaaaaggggattttattgaaattggagaaaaaggaata
ttgtggataaaatttgatatagaaggaaaacagtgtcatggaagcacaccagaaaatgga
gttaatgcagatgttatagcttttaactttgcaaatggactatataaacaactttatgag
aaatttgataatgttgatgagatctttctaccaaaatactcaacgtttgagccaacaatc
ttaaaaagtggggttgaaaatccaaatacaattcccgggcacgttgaagtggtatttgat
tgtagaattctacctacttatagtttagaagatgttttaaaagagatagataactttata
aaaacctttgattttagaggagggttaaaatattacgatccctcagtagagatgcaaata
aattataaaatactaaaagaggaacaaccaaattataccaaaaaagattccaaagttgta
ttagagttaaaaagagcaataaaaaaagttttaaacgaagatgcgaaattgtgtggaatg
ggtggagggactgttgcggcatttttaagattcaaaggatatgaagttgcagtttgggga
attggagaagaaacagcccaccaaccaaatgagcatataagaatagatgacttggttaaa
atggctaaggtattttatgagatcataaccccttctgattaa

DBGET integrated database retrieval system