KEGG   Mycoplasma wenyonii: WEN_00950Help
Entry
WEN_00950         CDS       T02179                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mwe  Mycoplasma wenyonii
Pathway
mwe00010  Glycolysis / Gluconeogenesis
mwe00051  Fructose and mannose metabolism
mwe01100  Metabolic pathways
mwe01110  Biosynthesis of secondary metabolites
mwe01120  Microbial metabolism in diverse environments
mwe01130  Biosynthesis of antibiotics
mwe01200  Carbon metabolism
mwe01230  Biosynthesis of amino acids
Module
mwe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WEN_00950 (tpiA)
   00051 Fructose and mannose metabolism
    WEN_00950 (tpiA)
   00562 Inositol phosphate metabolism
    WEN_00950 (tpiA)
Enzymes [BR:mwe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WEN_00950 (tpiA)
Exosome [BR:mwe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WEN_00950 (tpiA)
  Exosomal proteins of bladder cancer cells
   WEN_00950 (tpiA)
  Exosomal proteins of melanoma cells
   WEN_00950 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFN64991
UniProt: I6YAL2
Position
198365..199078
Genome map
AA seq 237 aa AA seqDB search
MASGKRIIGNLKMNFMRHELNYYFLELKKKFQNETPEHSLGLAVPYIYLEKTAEQLESAI
QLLAQDVHHLEKGAYTSSISAPQLSSINVRSTLIGHSECRALGQTAEIISEKVRIAILNG
FNVVYCCGKSPLTEIKKELFFINSANLDKLSIAFEPLSAIGSGSAMPPELVEKQLEEIKS
LVMEMWGEPGRKVPLLYGGSVSKTNYKSFLALSTCDGILVGSASLNIDSLWEMAMNR
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaggaaagagaattattggaaatctaaagatgaacttcatgagacatgaactc
aactactactttttggaattaaaaaagaaattccaaaatgaaacacctgaacatagctta
ggtttagctgtaccttatatctatctagaaaagacagctgaacaactggaatcagctatt
caattattggctcaagatgtacaccacctagaaaaaggtgcttacacctcttcaatttct
gctcctcaactgagttccataaatgttagatctactttaattggtcactctgaatgtaga
gcgctaggtcaaacagcagagattatctctgaaaaggtaagaatagcaatactaaatgga
tttaatgttgtttattgttgtggtaaatctcctttaacagagataaagaaagaattattc
tttattaactctgctaatctagataagctttctattgcttttgaacctttgagtgcaata
ggatctggttctgctatgccccctgaattagtagaaaagcaactagaagaaataaagtct
ttagttatggaaatgtgaggagagcctggaagaaaggttccattactgtatggaggatca
gtttcaaaaactaactataagtctttcttggcactctcaacttgcgatggaatactagta
ggtagtgcttcactaaatattgacagtctgtgagagatggcaatgaatagatag

DBGET integrated database retrieval system