KEGG   Mycoplasma wenyonii: WEN_01205Help
Entry
WEN_01205         CDS       T02179                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mwe  Mycoplasma wenyonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:mwe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WEN_01205
   01230 Biosynthesis of amino acids
    WEN_01205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WEN_01205
   00030 Pentose phosphate pathway
    WEN_01205
   00051 Fructose and mannose metabolism
    WEN_01205
   00052 Galactose metabolism
    WEN_01205
  Energy metabolism
   00680 Methane metabolism
    WEN_01205
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    WEN_01205
Enzymes [BR:mwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     WEN_01205
Protein phosphatases and associated proteins [BR:mwe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     WEN_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244881..245861
Genome map
AA seq 326 aa AA seqDB search
MRKVAVLTSGGDSPGMNSALYSFSELALSKGYEVVYIENGYQGLIEKRYIPYKLNCLRGR
TYNAGTVIGSSRSSQFRASPELRAEGVKALKDQGVEALVVLGGNGSYEGSKLISQLGLPV
ILLPATIDNDVSSTKYTIGFFSALEEIGQAIKKIWYTANSHSQLTIVEVMGRDCSDLGVF
ASYSSPLVELVITQQNVPSYEELREKVRKIREFRGNKGLVIVVVEKVLGVSQLPSMSELT
KKLEEDLGFTVRGCSLGHTQRGATPTTWEMFVASSFGREAFNSFEAREFDVAIGFDGDNF
YRTKLSEVVDKSKGDRISLIESKDRF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaggtagctgttttaacttctggaggagattctccaggaatgaacagtgccctt
tattcctttagtgaattagctctttctaagggctatgaagttgtatatatagagaatggt
tatcaaggcttaattgaaaagagatatatcccatacaaacttaattgcttgagaggaaga
acttacaatgcaggaactgtaataggttctagtagatcttctcagttcagagcttctcct
gagttaagagcagaaggagtaaaggctcttaaagatcaaggagttgaagctttagtggta
ttgggaggaaatggctcctatgaaggatctaagttaatctctcaattaggacttccagtt
attcttcttcctgcaactattgataatgatgtcagttcaactaaatacaccattggtttc
ttttcagccctagaagaaataggacaagcaattaagaaaatttgatacactgcgaactca
cattcacaattaaccattgttgaggttatggggagagattgctctgatttaggagtattt
gcctcttattcctctcctttagtggagttagttattactcaacaaaatgtacctagttat
gaagagctaagagagaaggttagaaagattagagaatttagaggcaataagggattagtg
attgttgtagttgaaaaggttttgggagtttctcaactaccttctatgtctgagttaaca
aagaagttagaggaagatcttggatttacagttagaggttgttctttgggacacactcaa
agaggagctactccaaccacttgagagatgtttgttgcttcttcttttggaagagaagct
tttaactcttttgaggccagagagtttgatgtagctataggttttgatggagataatttc
tatagaactaaactatcagaagttgttgataaaagtaaaggagatagaatctctttaatt
gaatccaaggatagattctag

DBGET integrated database retrieval system