KEGG   Mycoplasma wenyonii: WEN_01205Help
Entry
WEN_01205         CDS       T02179                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mwe  Mycoplasma wenyonii
Pathway
mwe00010  Glycolysis / Gluconeogenesis
mwe00030  Pentose phosphate pathway
mwe00051  Fructose and mannose metabolism
mwe00680  Methane metabolism
mwe01100  Metabolic pathways
mwe01110  Biosynthesis of secondary metabolites
mwe01120  Microbial metabolism in diverse environments
mwe01130  Biosynthesis of antibiotics
mwe01200  Carbon metabolism
mwe01230  Biosynthesis of amino acids
mwe03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mwe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WEN_01205
   00030 Pentose phosphate pathway
    WEN_01205
   00051 Fructose and mannose metabolism
    WEN_01205
   00052 Galactose metabolism
    WEN_01205
  Energy metabolism
   00680 Methane metabolism
    WEN_01205
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    WEN_01205
Enzymes [BR:mwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     WEN_01205
Protein phosphatases and associated proteins [BR:mwe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     WEN_01205
Messenger RNA biogenesis [BR:mwe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     WEN_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK PucR
Motif
Other DBs
NCBI-ProteinID: AFN65040
UniProt: I6ZIM7
Position
244881..245861
Genome map
AA seq 326 aa AA seqDB search
MRKVAVLTSGGDSPGMNSALYSFSELALSKGYEVVYIENGYQGLIEKRYIPYKLNCLRGR
TYNAGTVIGSSRSSQFRASPELRAEGVKALKDQGVEALVVLGGNGSYEGSKLISQLGLPV
ILLPATIDNDVSSTKYTIGFFSALEEIGQAIKKIWYTANSHSQLTIVEVMGRDCSDLGVF
ASYSSPLVELVITQQNVPSYEELREKVRKIREFRGNKGLVIVVVEKVLGVSQLPSMSELT
KKLEEDLGFTVRGCSLGHTQRGATPTTWEMFVASSFGREAFNSFEAREFDVAIGFDGDNF
YRTKLSEVVDKSKGDRISLIESKDRF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaaggtagctgttttaacttctggaggagattctccaggaatgaacagtgccctt
tattcctttagtgaattagctctttctaagggctatgaagttgtatatatagagaatggt
tatcaaggcttaattgaaaagagatatatcccatacaaacttaattgcttgagaggaaga
acttacaatgcaggaactgtaataggttctagtagatcttctcagttcagagcttctcct
gagttaagagcagaaggagtaaaggctcttaaagatcaaggagttgaagctttagtggta
ttgggaggaaatggctcctatgaaggatctaagttaatctctcaattaggacttccagtt
attcttcttcctgcaactattgataatgatgtcagttcaactaaatacaccattggtttc
ttttcagccctagaagaaataggacaagcaattaagaaaatttgatacactgcgaactca
cattcacaattaaccattgttgaggttatggggagagattgctctgatttaggagtattt
gcctcttattcctctcctttagtggagttagttattactcaacaaaatgtacctagttat
gaagagctaagagagaaggttagaaagattagagaatttagaggcaataagggattagtg
attgttgtagttgaaaaggttttgggagtttctcaactaccttctatgtctgagttaaca
aagaagttagaggaagatcttggatttacagttagaggttgttctttgggacacactcaa
agaggagctactccaaccacttgagagatgtttgttgcttcttcttttggaagagaagct
tttaactcttttgaggccagagagtttgatgtagctataggttttgatggagataatttc
tatagaactaaactatcagaagttgttgataaaagtaaaggagatagaatctctttaatt
gaatccaaggatagattctag

DBGET integrated database retrieval system