KEGG   Mycoplasma wenyonii: WEN_01295Help
Entry
WEN_01295         CDS       T02179                                 

Gene name
gltX
Definition
glutamyl-tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
mwe  Mycoplasma wenyonii
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mwe00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    WEN_01295 (gltX)
Enzymes [BR:mwe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     WEN_01295 (gltX)
Amino acid related enzymes [BR:mwe01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   WEN_01295 (gltX)
Transfer RNA biogenesis [BR:mwe03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    WEN_01295 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
270282..271739
Genome map
AA seq 485 aa AA seqDB search
MAEENQRVVRTRFAPSPTGSLHIGGLRTALINYLFAKQHNGGFILRIEDTDRERHQEEQV
KKIWDSLVSMSVTPDESPESPGDVGPYLQSERLDRYIYRINQLLKAGKAYRCFCEGDNSE
ETKTHFYSGKCRNLSKEEIKEKLEQGLSHCVRLKVDQSKVYSWTDYVRGKMFISATALGD
IILMRSSGLPTYNFAVVVDDYEMKITDVFRGEEHISNTPYQIALYEAFGWGDSLPRFGHL
SLILSEAGRKISKRDEDSDRYFVDYFLNQGYYPEAILNYLLTLGWSEGEREFFKLKEAIE
HFSTSGLSGSPSTFDFKKLEWMSQSYLNQLDLHQYLNFVLPFFKGELKDYQLTKEQKTEF
AIRFRSRVKYASFLDELASAFYSTNYLTKEVIDQLKSFEGVTSLIQKTLECLSETSPEDF
KEEKEIQKFLKILCAKLEIKKHDFYTNLRLVLTGEAEGLPLFSIFFLLGPEKSKERLEKA
LKQLS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagagaaccaaagagtagtaagaactagatttgctccatcaccaactggctct
ttacacattggtggattaagaacagctcttattaattatttatttgccaagcaacacaat
ggaggattcatcttacgaatagaagatacagatagggaaagacatcaagaagaacaagtt
aagaagatctgagatagtttagtttctatgtctgtcactcccgatgaatctccagaatcg
cccggagatgttgggccttatcttcagtctgagagactagatagatacatatatagaata
aaccagctattaaaggctggtaaggcctatagatgtttttgtgagggggataactcagaa
gaaacaaagactcacttttattctggtaagtgtcgcaacttatctaaggaagagataaag
gagaagttggaacaaggactttctcactgtgtcaggttaaaggtagatcagtcaaaggta
tatagttgaacagactatgtgaggggaaagatgttcatctctgctactgcattaggagac
attattctaatgaggagtagtggattacctacctataactttgctgttgtagttgatgat
tatgagatgaagataacagatgttttcaggggagaagaacacatctctaatactccttac
caaatagctttatatgaagcttttggctggggagactcacttcctagatttggacatctc
tccttaattctctctgaggcaggtagaaagatctctaagagagatgaagattcagataga
tattttgtggattatttcttgaatcaaggatattatccagaggcaatacttaattactta
ttgacactaggatgatcagaaggagagagagaattctttaagttaaaagaagcaatagaa
cacttttctactagtggtttaagtggctctccctctacttttgatttcaagaagttagag
tgaatgagtcagtcttatttgaatcaattagatttacatcaatatctgaactttgtacta
cctttctttaagggtgaactgaaagactatcagttaactaaagaacaaaagacagagttt
gcaattagattcagatcaagagttaagtatgcctctttcttagatgagttagctagtgct
ttttactcaactaactatctaactaaagaggttatagatcagttaaagagttttgaggga
gttacctctttaattcaaaagactttagagtgcttaagtgaaacaagtcctgaagacttt
aaagaagagaaggagatacaaaagttcttaaagatactttgtgcaaaactagagataaag
aaacatgacttttataccaacttgagactagttttgactggagaagctgaaggtcttcca
ctcttctctatctttttcttattaggaccagagaagtctaaggagagactagagaaggcc
ttaaaacaacttagttag

DBGET integrated database retrieval system