KEGG   Mycoplasma wenyonii: WEN_02745Help
Entry
WEN_02745         CDS       T02179                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mwe  Mycoplasma wenyonii
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mwe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    WEN_02745
Enzymes [BR:mwe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     WEN_02745
Exosome [BR:mwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WEN_02745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516777..517871
Genome map
AA seq 364 aa AA seqDB search
MWVSSYCSAPKFNYLIKEVIPCLNTEWLWGTLDCWLIYLLSEGRYFVTDYVSASRTALLN
LKSLEWDKELCELFEIPREKFPSLCENAREIGSVKLFGKYNLILKGVIGDQQGALYTTYR
LREEGGKLPISLVYGTGAFLLQLLPSGKTFEEIYSSLPENSPLSISLAWVVDSKASYALE
LGISNSGKALEWLLSLMKLQASEIERVLEPENINWESLPFSIPTLSSKFLFSTPENYSAS
IFNLCYESKEKELIVSFLESMSFSVKVATELLSFNPKRNYIVVGGGLSKNTFFLELQSSC
LDCPLTIYQSEHLSGLGSAFLTFPESSKIPSLEHKKIIPNSNYSAFLNKRFKTWKKKLKV
CQVI
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgtgagttagttcttattgctcagcccctaaattcaactatctaataaaggaagttatt
ccttgcttaaatacagagtgactctgaggtactttagattgttgactaatttatctctta
agtgaaggtagatattttgttactgattatgtttcagcttcaagaacagctttacttaat
ctcaaaagtctagagtgagataaagagctttgtgaattatttgagattccaagagagaaa
tttcctagtctttgtgaaaatgcacgagaaataggctctgttaagttatttggaaaatac
aacctaatactcaaaggagttataggagatcagcaaggagctctttatacaacctataga
ttgagagaggaggggggcaaattacctatctctttggtatatggaacaggagcttttttg
ctccaattactaccaagcggaaagacttttgaagaaatctattcttctcttccggaaaat
agtcctttgtcaattagcctagcttgagttgttgactctaaagcgagttatgcattagaa
ctaggtatttctaattctggtaaggctttagagtgactcttaagtctaatgaaattacag
gcaagtgagattgagagagtactagagcccgagaatataaactgagaatctcttcctttc
tcaatacctactctctcaagtaaattcttattctcaactccagagaactactctgcctct
attttcaatctttgttatgagtcaaaagagaaagaattaatagtttctttcttggagtca
atgtcttttagtgtgaaagtagctacagagttactttcttttaatccaaaaaggaactat
atagttgttgggggaggattaagtaaaaatactttcttcttggaattacagtctagttgt
ttggattgccccctaactatctatcaatcagaacacttaagtggtttaggttctgctttt
cttactttccctgagagctctaagattccttcccttgagcacaaaaagattattcctaac
tctaactattcagctttcttaaataaaagatttaagacttgaaaaaagaaactaaaagtg
tgtcaagttatttaa

DBGET integrated database retrieval system