KEGG   Myxococcus xanthus: MXAN_0084Help
Entry
MXAN_0084         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
96070..96987
Genome map
AA seq 305 aa AA seqDB search
MASSDTHLAWDPKTLNHTERPSGFGCLWRHTITDNGGWSSHPCNHMSNCYEVSLNERSAL
YNKDHQAIARRMKLVQEDFALSSKAKKRIWKRFPVSDNSKRKLTLSDFFDKGRQSLYWLR
RGPEGWHIGVKHLDPVPNQTLKKGNRPQFQPRQNQLQGGYGAFYPYEHNYHHLIPVGAVE
EWVIGKGESGSPARSDQVVKLILISRWNIHNEKNMVLLPQQEFEALIVGLPAHCPWGVPA
HAAYQSSLQGRLRKLRSKIDRAIRQKKHPKDLKADIIEELDSLSNALLSQVENMRAGVQL
GPVNV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcatccagcgatacgcatctggcgtgggacccgaagacgctcaaccacacggagcgg
ccctctgggttcgggtgcctctggcggcacacgataacggacaacggcgggtggagttct
cacccgtgcaaccacatgtccaactgctacgaggtgtccttgaacgagcggagcgcgctc
tacaacaaggaccatcaggcgattgcccggcggatgaagctcgtccaggaggacttcgcc
ctgagcagcaaggcgaagaagcgcatctggaagcgcttccccgtcagtgacaactcgaag
cggaagctgaccctgtcggacttcttcgacaaggggcggcagtcactctactggctgcgc
cgggggccggaggggtggcacatcggggtgaagcacctggacccggtgcccaaccagacg
ctgaagaaggggaaccggcctcagtttcagccgcgtcagaatcagctccagggcgggtat
ggggccttctatccctacgagcacaactaccatcacctcatcccggtcggcgccgtcgag
gagtgggtcatcggcaagggcgagtcggggagcccggcgcgctccgaccaggtggtgaag
ctcatcctcatctcgcggtggaacatccacaacgagaagaacatggtcctgctgccgcag
caggagttcgaggcgctcatcgtgggcctgccggcccactgcccttggggcgtgcccgcg
catgcggcgtatcagtcgtcgctccaggggcggctgcgtaagttgcggagcaagatagat
cgtgcaatccgccagaagaagcaccccaaggacctcaaggcggacatcatcgaggagctg
gattcgctgtcgaatgcactgctgagccaggtcgagaatatgagagcgggtgttcagctc
ggacccgtgaatgtttag

DBGET integrated database retrieval system