KEGG   Myxococcus xanthus: MXAN_0086Help
Entry
MXAN_0086         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
97598..98335
Genome map
AA seq 245 aa AA seqDB search
MDSVLDNILFLVGQRMPRLQSSSAKPDAKLTLETAALWRQYGCGLLLSELDDEGFRDGLE
QAATLYLNLLNRRSACSEFDQYYLARSKGEPLLDALAAGNWDLARSIAAAMTPTWMQRME
SEEDFHYFGALIALVLAQSHLGAELAAFERTLQGGGSHRFDVVQALSKQEADAFDAGLHG
MIEEQAAWVERQRRSGLFDPYRHKTEAFVFVEGAALVQLARRLGVPTQERYRLIPSAALE
LQART
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggattcggtcctcgacaacatccttttcctcgtaggccagcggatgccccggctccag
tcgtcgtcggcgaagccggacgcgaagctgaccttggagaccgccgcgctctggcgtcag
tacggctgtggcctcctgttgtcggagttggacgatgaaggcttccgagacggcctggag
caggcggcgacgctctacctgaacctgctcaaccgccgcagcgcgtgctccgagttcgac
cagtactacctggcccgcagcaagggcgagccgctcctcgacgcgctggctgcgggcaac
tgggacttggcccgctccatcgccgccgcgatgacgccgacctggatgcagcggatggag
tcagaggaggacttccactacttcggcgccctcatcgccctggtgctcgcgcagtctcac
ctgggcgcggagctcgccgcgttcgagcggacgctccagggcggaggctcccaccgcttc
gacgtggtgcaggccctgtcaaagcaagaggccgatgccttcgacgcgggcctccacgga
atgattgaggagcaggccgcctgggtcgagcgccagcggcgctccggcctgttcgatccc
taccgccacaagacggaggccttcgtcttcgtcgaaggcgccgcgctggtccaactggcc
cgccgcctgggcgtaccgacgcaggagcgctatcgcctcatcccctctgctgccttggaa
ctccaggcccgcacttga

DBGET integrated database retrieval system