KEGG   Myxococcus xanthus: MXAN_0092Help
Entry
MXAN_0092         CDS       T00366                                 

Definition
(GenBank) efflux transporter, HAE1 family, inner membrane component
  KO
K18146  
multidrug efflux pump
Organism
mxa  Myxococcus xanthus
Pathway
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    MXAN_0092
Transporters [BR:mxa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   MXAN_0092
Antimicrobial resistance genes [BR:mxa01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AdeABC [MD:M00649]
    MXAN_0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
103480..106620
Genome map
AA seq 1046 aa AA seqDB search
MPRFFIERPVFAWVIAIFIVLAGAISIPRLPIERYPSIAPPSVTITATYPGATPAAMNDS
VVSLIERGLSGVKNILYFESSSDTSGIAQIVVTFAPGTDPDLAQVDIQNRLKTVESRLPQ
MVRQLGLQVETTTTNFLLFSTLVSSDGRYDEAELGDFLSRNVVEDLRRVPGVGRVQLFTP
ARALRVWLDPERLISHGISVDEVAAAIRAQNAEASPGRLGDMPAVPGQRVTTPLMLQGQL
LDVADFERVIIRANPDGSNVLLKELAKVELGPQSYASSTRQNGKNAATFGVQLAPGANAL
DTSERIRERMADLSRAFPAGVEYTIPYDAAPFVRVSIQKVVQTFFEAMLLVFAVMYLFLQ
SVRYTLIPAIVAPIALLGTFAVMLASGFSINVLTMFGMVLAIGIIVDDAIVVVENVERLM
AEEGLSPLEATKKAMKEITGAVIGITLVLTSVFIPMAFATGSVGTIYRQFSLAMAVSILF
SAFLALTLTPALCATLLRPVEPGHAGKRRGFFGGFNRLLERVTGRYANWTRAIVGRLGRA
FFAYAVVVAMVALAFWRLPGAFFPEEDQGFLNVSVQLPSDATAERTNSVLGELEAFLSER
EGIQDVLTIQGFGFFGSGANAGLMFVMMRDWDERQGETAAGEVAAANARFASPREGMVIN
VLPPAVDGLGNSAGFAMRLEDRAGHGPQALNDAMNHVLRRASDSPVIAFPYQEGLPDGST
VRIQVDRERAAALGVSFAEINSVISTALGSTYVNDFPNKGYMQQIILQARAESRMQVEDV
LKLPVRNARGQMVPLSSVAEPVWERGPMQLVRYNGYPAVRIAGAAAPGFSSGDAMAEMER
IAGELPPGFAVEWTGLSYQERLSGSEAPILLALSMLVVFLVLAALYESWSIPLSVMLVVP
LGLIGALAAVMSRGLMNDIFFKVGLITIIGLSAKNAILIVEFAKQLEEQGRSPLQAAVEA
ARLRFRPILMTSLAFALGVVPLVVASGASAETQRAIGTGVFGGMVSGTVLAIFLVPAFYV
AVRSLLKRRESASPAPLVKHAPAENS
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
gtgccaagattcttcattgaacgcccggtcttcgcctgggtgattgccatcttcatcgtg
ctcgccggagccatctccattccccggctccccatcgagcgctacccgtccatcgcgccg
ccgagcgtgacgattaccgccacctatcccggcgccacgccggccgcgatgaacgacagc
gtcgtgtcgttgattgagcgcggcctgtccggcgtgaagaacatcctgtacttcgagtcg
tcgagcgacacgtcgggcatcgcgcaaatcgtggtgacgttcgcgcccggaacggacccg
gacctggcgcaggtcgacatccagaaccgtctgaagaccgtcgaatcgcggctgccgcag
atggtccggcagctcgggctccaggtggagacgaccaccaccaacttcctgctcttctcc
acgctcgtgtcgagcgacggccgctacgacgaggccgagctgggggacttcctgagccgc
aacgtggtcgaggacctgcgccgcgtgcccggcgtggggcgcgtccagctcttcacgccg
gcccgcgcgctgcgcgtctggttggacccggagcggctcatctcgcacggaatctccgtg
gatgaggtcgcggcggcgattcgcgcacagaacgcggaggcctctcccggacggctgggg
gacatgcccgcggttccaggccagcgcgtcaccacccccctgatgctccaggggcagctc
ctggacgtcgcggacttcgagcgcgtcatcatccgggccaatccggatggctcgaacgtg
ctgctcaaggaactcgccaaggtggagctggggccccagagctacgcctcgtccacccgg
cagaatgggaagaacgccgccacgttcggcgtgcagctggccccgggggcgaacgcgctc
gatacctccgagcgcatccgcgagcggatggcggacctctcccgggcctttcccgcgggc
gtcgagtacacgattccgtacgacgcggcgccgttcgtgcgcgtctccatccagaaggtc
gtccagaccttcttcgaggcgatgctgctcgtcttcgcggtgatgtatctcttcctgcag
agcgtgcgttacacgttgattcccgccatcgtcgcgcccatcgcgctgctgggaaccttc
gcggtgatgctggcgtcggggttctccatcaacgtgctgacgatgttcggcatggtgctg
gcgattggcatcatcgtcgatgacgccatcgtcgtggtcgagaacgtcgagcgcctcatg
gcggaggaggggctttctcccctcgaggccacgaagaaggcgatgaaggaaatcacgggc
gccgtcatcggcatcaccctggtgctcacgtccgtgttcatccccatggcgttcgccacg
ggctccgtcggcaccatctaccgccagttcagcctggcgatggccgtgtcgattctcttc
tccgcgttcctcgcgctcacgctcaccccggcgctctgcgcgacgctgctgcgcccggtg
gagcccggccacgcggggaagcgccgcggcttcttcggcggtttcaaccggctcctggag
cgggtgacggggcgctatgcgaactggacccgggccattgtcgggcgtctgggccgggcg
ttcttcgcgtacgccgtggtggtcgccatggtggccctggcgttctggcggctgccgggc
gccttcttcccggaggaggaccaggggttcctcaacgtctcggtgcagctcccgtcggac
gccacggccgagcggacgaacagcgtgctcggggagctggaggccttcttgagcgagcgc
gagggcatccaggacgtgctgaccatccagggcttcggcttcttcggctcgggggcgaac
gctggcctcatgttcgtgatgatgcgcgactgggacgagcgccagggggagacggcggcg
ggtgaggtcgccgccgccaacgcgcgcttcgcctctccgagggagggcatggtcatcaac
gtgctgccgcccgcggtggacgggctcggcaacagcgcgggcttcgccatgcggctggag
gaccgtgccggacacggcccgcaggcgctcaacgacgccatgaaccacgtcctccggcgc
gcctcggacagtccggtcatcgccttcccctatcaggaggggttgccggacggctcgacg
gtgcgaatccaggtggaccgtgagcgcgcggcggcgctcggtgtgtcgttcgcggaaatc
aactcggttatctccaccgcgctggggtcgacgtacgtcaacgacttccccaacaagggc
tacatgcagcaaatcatcctgcaggcgcgcgcggagtcccgcatgcaggtggaggacgtg
ctcaagctccccgtgcgcaacgcgcgcgggcagatggtgcccctgtcctcggtggccgag
cccgtctgggagcgggggcccatgcagttggtccgctacaacggctaccccgccgtgcgc
atcgccggggcggcggcaccgggcttcagcagcggtgacgccatggcggagatggagcgc
atcgcgggcgaactaccacccggcttcgcggtggagtggacggggctctcctatcaggag
cggctctccggctcggaggcgcccatcctcctggcgctgtcgatgctcgtcgtcttcctg
gtgctggcggcgctctacgagagctggtcgattccgctgtcggtcatgctcgtcgtgccg
ctgggactcatcggcgcgctggcggccgtgatgtctcgcgggttgatgaacgacatcttc
ttcaaggtgggcctcatcaccatcatcggcctgtccgcgaagaacgcgattctcatcgtc
gagttcgcgaagcagctcgaggagcagggacgctcaccgctccaggccgcggtggaggcg
gcgcggctgcgtttccgtcccatcctgatgacgtcactcgccttcgccctcggcgtggtg
ccgctggtggtggccagcggcgcgagcgcggagacgcagcgggccatcggcacgggcgtg
ttcggcggcatggtgtcaggcaccgtcctggccatcttcctggtgcccgcgttctacgtc
gccgtgcggagcctgctcaaacggcgcgagtcggcgagcccggctcccctcgtgaagcac
gcgcccgcggagaacagctag

DBGET integrated database retrieval system