KEGG   Myxococcus xanthus: MXAN_0095Help
Entry
MXAN_0095         CDS       T00366                                 

Definition
(GenBank) sensory box histidine kinase/response regulator
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(108152..110458)
Genome map
AA seq 768 aa AA seqDB search
MAAPWQPKGSMSTEQWAHRFFELSTEPYVILGRDGVLLEANPAFGHLVGLSLTSLRGMAL
QDFIPIEDAAVLFAHLGSTSPTSRTCRWRRPDGSWLPLSWRITAASESEPLYCTVQRAEE
PSAAPWPESDYLPFGLYLVDIRTRRVHYVNHRFCQLWGITELEGAIQRGELSHDEVIHHC
LKAGDAAEFLRLCAAPDQGCVPGLVEDEARLSDGRTLRRLSTSSSVAGDAMRYRMFAFED
VTESKRTQEALRRSEESFRRLIDRAPEGIFVHTQRRFIYANPTLLRALGYDDPAELMAKP
IWSIVHPDDLELVKDRVHTAAVKGALAPLREVRYLRRDGTWYDAESVGIPIEFDGHEAVV
VMARDITERKQAQSQLLQNDRMVLAGTLAAGVGHEINNPLTYVMANLASALESVSRLGAE
LTRAGERGPSSVAWPATLHDAEALLKEAQEGAMRVRNIVRDLKFISRQDEERREAVDVRQ
PLDFSINMAASQLRHRARLIKKYESVPRVYADGSRLGQVFLNLLVNSAQAIPEGNAEEHH
ITVWVRAGPPGSVLVDVSDSGCGMTPAVLSRVFDPFFTTKPVGKGTGLGLSICHSLIRKQ
GGDITVRSELGQGTTFTVTLPTAPDAVPTQAAPVAPAPHAERRGQVLVIDDEPAVGRSLA
RIIGMRHRVTVVNNGEDALAVLTSGAPFDAVFCDLMMPGISGMDVYERVRERGDGIAERF
IFITGGSYTTRARQFLERVPNLQIEKPFDVESIHQGLGQLLGASRGSE
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
ttggctgcgccctggcaacccaagggaagcatgtcgacagagcagtgggcccaccgcttc
ttcgagctgtccacggagccctacgtcatcctgggccgtgatggcgtgttgctcgaagcc
aatcctgcctttggccacctggtgggcctgtctttgacgtcactgcgtggcatggccttg
caggatttcatccccatcgaagatgccgccgtcctgttcgcgcatctgggttccacaagc
cccacctcgcgcacctgccgttggcgccggccggatgggtcctggctgcctctgtcctgg
cgcatcaccgccgcttcggagtcggagccactctactgcacggtgcagcgggccgaggaa
ccatccgccgccccctggccggagagtgactacctgcccttcggcctctacctggtcgac
atccgcacgcgccgggtccactacgtcaaccaccgcttctgccaactgtggggcatcacc
gagttggagggcgccatccagcggggtgagttgtcccatgacgaggtgatccaccattgc
ctcaaggctggcgacgcggcggagttcctgcgcctgtgcgcggccccggaccagggctgc
gtgccgggcctggtggaggacgaagccaggctgtcggatggacgcaccctgcgacggctg
tccacgtcctcctcggtcgcgggggacgccatgcgctaccggatgttcgcgttcgaggac
gtcaccgagagcaagcgcacgcaggaggcgctgcgccgttcagaggagagcttccgcagg
ctcatcgaccgggcgcccgaaggcatcttcgtgcacacccagcggcgcttcatctacgcc
aaccccacgctgctgcgggccctgggctacgacgacccggccgagctgatggcaaagccc
atctggagcatcgtccatccggatgacctggagctcgtgaaggaccgcgtgcacaccgcg
gccgtgaagggcgcgctggccccgctgcgggaggtccgctacctgcggcgcgacggcacc
tggtacgacgcggagagcgtgggcatccccatcgagttcgacggacacgaggccgtcgtg
gtgatggcgcgcgacatcaccgagcgcaagcaggcccagtcgcagctcctgcagaacgac
cgcatggtgctggccggcacgctggcggcgggcgtggggcacgaaatcaacaacccgctg
acctacgtcatggccaacctggcctcggccctggagtccgtgagccgcctgggcgcggag
ctgacgcgggccggagagcgcggtcccagcagcgtggcgtggcccgcgacgctgcatgac
gcggaggccctgctgaaggaggcgcaagaaggcgccatgcgcgtgcgcaacatcgtgcgg
gacttgaagttcatctcccgtcaggatgaggagcggcgcgaagcggtggacgtgcggcag
ccgttggacttctccatcaacatggccgccagccaactgcgtcaccgggcgcggctcatc
aagaagtacgagtccgtcccccgcgtgtacgcggacggctcgcgcctgggccaggtgttc
ctcaacctgctggtgaactcggcgcaggccattcccgaaggcaacgccgaggagcaccac
atcaccgtgtgggtccgcgccggaccgccgggcagcgtgctggtggacgtgagcgactcc
ggctgcggcatgacgcccgcggtgctctcccgcgtcttcgaccccttcttcaccaccaag
cccgtgggcaagggcacggggctggggctgtccatctgccacagcctcatccgcaagcag
ggcggtgacatcaccgtccgcagcgaactgggccagggcaccaccttcaccgtcaccctg
cccacggcgccggacgccgtcccgacccaggccgcgccggtggcgcccgcgccccacgcc
gagcggcggggacaggtgctggtgattgacgacgagcccgcggtgggccgctccctggcg
cgcatcatcggcatgcggcaccgggtgacggtggtgaacaacggcgaggacgcgctggcg
gtgctgacatcgggcgcgccgttcgacgccgtcttctgcgacctgatgatgccgggcatc
tccggcatggacgtctacgagcgcgtccgcgagcgcggggatggcatcgccgagcgcttc
atcttcatcaccggcggctcgtacaccacgcgggcccgtcagttcctggagcgcgtgccg
aacctgcagattgagaagcccttcgacgtggagtcgattcatcagggcctgggacaactc
ctgggtgcctctcgtggtagcgaatga

DBGET integrated database retrieval system