KEGG   Myxococcus xanthus: MXAN_0098Help
Entry
MXAN_0098         CDS       T00366                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF262
Motif
Other DBs
NCBI-ProteinID: ABF91082
UniProt: Q1DG42
Position
complement(112585..114258)
Genome map
AA seq 557 aa AA seqDB search
MQSTLTRRPQATAFSIEDLLDRVQRGEVRLPHFQRPLRWEAGDVRDLLDSVYRGYPIGTL
LFWKREAPAASVSFGPVRIDAPSHSQALWVVDGQQRITALAAVLLHPEQEPAARDGFTLF
FDLDTHEIVQPAHGEPTPPHWLPLNRVLDSEQLLGWLDRYPGREKNPEHVRAAIRLGKAA
REYQMPAYVVEAAEEKTLRIIFKRLNTSGKPLTDDEVFNALYGGTAGSRLPNLKALATSL
LELGFGRIDESLLLKAVLAVRGLDFTQDFQKQLREEDDLTQTLLQTEAALRSVIVFLKRD
AGIPHGRLLTNPLYFVLLARFFHLHPEPSPRTRDLLARGFWRGSLVDSFLDSRALSPQEL
LAAIGPDEEQSVQSLLAQVRPLSDEWLAQHAQPATFGLALRSRGMALNALYALQPRHLRT
GALLEPSQLFSDTDPASLSPVLKSLTVQEPDAELKLDPALYRSFLYTPANYLMHPPLPGQ
PLLDVLRDEPAPPPEVLQSQAITPAMRDTLREGGTLEFLMQRMELIDRHIIEFLRARTRY
EESDRPSLQSLVVEEED
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccaccctgacgcggcggccccaggcgacggcattcagcatcgaggatctgctg
gaccgcgtccagcgcggtgaggtgcggctgccccacttccagcggcccctgcgctgggag
gccggcgatgtgagggatttgctcgacagcgtgtaccgcggctatcccattggcacgctg
ctcttctggaagcgcgaggctcccgccgccagcgtgagcttcggcccggtgcgcatcgac
gcgccctcccacagccaggcgctgtgggtggtggatgggcagcagcgcatcaccgcgctg
gccgcggtgctcctccacccggagcaggagcccgccgcgcgggacggcttcacgctcttc
ttcgacctggatacacacgaaatcgtccagcccgcgcacggcgagccgacgcctccgcac
tggctgccgctcaaccgggtgctcgacagcgagcagctgctgggctggctggaccgctac
ccggggcgcgagaagaacccagagcacgtgcgcgcggccatccgtctgggcaaggcggcg
cgcgagtaccagatgcccgcgtacgtcgtcgaagccgcggaggagaagacgctgcgcatc
atcttcaagcggctcaacacctccggaaagccgctcaccgacgacgaggtcttcaacgcg
ctctacggcggcaccgcgggctcgcgactgcccaacctgaaggcgctggccaccagcctg
ctggagctgggcttcggccgcatcgatgaatccctgctgctcaaggccgtgctcgcggtg
cgcggcctggacttcacccaggacttccagaagcagcttcgcgaggaggacgacctcacg
cagacgctgctccagacggaagcggccctgcgcagcgtcatcgtcttcctcaagcgcgac
gcgggaatcccccacgggcgcctgctgacgaacccgctctacttcgtgctgctcgcgcgc
ttcttccacctgcacccggagccgtcgccgcgcacgcgggacttgctcgcgcgtgggttc
tggcgcggcagcctggtggacagcttcctcgacagccgggccctgtcgccacaggagttg
ctggccgccatcggccccgacgaggagcaatccgtccagtccctgctggcgcaggtgcgg
cccctgtccgacgaatggctggcccagcacgcgcagcccgcgacgttcggcctcgcgctg
cgctcgcggggcatggccctcaatgccttgtacgcgctccagccgcggcacctgcgcacc
ggcgccctgctggagccgtcccagctcttcagcgacaccgaccccgccagcctcagcccc
gtgctcaagtccctcaccgtgcaggagcccgacgccgagctgaagctggaccccgcgctg
taccgctccttcctctacacccccgccaactacctgatgcacccgcccctgcccggtcag
cccctgctggacgtgctgcgggacgagcccgcgccgccgcccgaggtcctccagagccag
gccatcacccccgccatgcgcgacacgctgcgcgagggcggcacgctcgaattcctcatg
cagcgcatggagctcatcgatagacacatcatcgagttcctgcgggcccgcacccgctac
gaggagtcggaccgtccgtccctccaatcgctggtcgtcgaggaggaggactga

DBGET integrated database retrieval system