KEGG   Myxococcus xanthus: MXAN_0100Help
Entry
MXAN_0100         CDS       T00366                                 

Definition
(GenBank) peptidase, M28D (aminopeptidase ES-62) subfamily
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
114710..116215
Genome map
AA seq 501 aa AA seqDB search
MPVATFILPASLALQLLSAAAPAAKSAPKAVPAKPTVTAKRAAPVYAQATAEKLIGPALT
DGHAYARLAELTDGIGPRLSGSPGAEAAVQWALRSFKADGVKAWLEPVKVPHWVRGEASG
EVLASERTRGHPLALLALGGSPPTAPEGLTAEVVEVTSLEQLESLGAAVKGKFVFFNHTM
TVAADYGRFAGLRSRGPAAAAKHGAVGALVRSLATASLRTPHTGATNFPSEGPRIPAASV
ATEDADLLHRLLAGGPVRVKLMLGSSELPDADSSNVVAEIRGREKPQEIVLIGAHLDSWD
VGTGAHDDGAGVVMVMEAARLIAKLPQAPRRTVRVVLFMNEENGLRGGRAYAEAHAAELP
RHVGALEMDAGGGRPVSVSVRAGEGGQDLLRPWLPPLTALGVTQFSAREAGGADISPLMP
ARVPFFGVEVDSSRYFDVHHTEADTLDKVDPQDLARSTAAVAWMTYALAEMPGTLTRPEA
PAPRGPAPVTVPAQQSKTSGN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtcgccaccttcatcctgcccgcttccctcgcgctccagttgctgtcggccgcc
gcacccgccgcgaagtcggcgcccaaggccgtccccgcgaagcccaccgtcaccgcgaag
cgtgccgcgcccgtgtacgcgcaggcgaccgcggagaagctcattgggcccgcgctcacg
gatggccatgcctatgcgcggctcgccgagctgacggacggcattggcccgcgcctgtcg
gggtcgccgggcgccgaggccgccgtgcagtgggcgctgcgttctttcaaggccgacggg
gtgaaggcgtggttggagccggtgaaggtgccgcactgggtgcgaggcgaggcgtccggc
gaggtgctggcctccgagcgcacgcgggggcaccccctggcgctgctggccctgggcggc
agcccgcccaccgcgcccgagggactcaccgccgaggtggtggaggtgacgtcgctggag
cagttggagtcgctgggcgcggcggtgaaggggaagttcgtcttcttcaaccacaccatg
acggtggccgcggactacgggcgcttcgcggggctgcgctcacgaggccccgccgccgcc
gcgaagcacggggcggtgggcgcgctggtgcgctcgcttgccacggcgtcgctgcgcacg
ccgcacacgggcgcgacgaacttccccagtgaggggccgcggattccggcggcgtcggtg
gccacggaggacgcggacctgctccaccggctgctggcgggcggcccggtgcgcgtgaag
ctgatgctgggcagttccgagctgccggacgcggattcctccaacgtcgtggcggagatt
cgcggccgggagaagccgcaggaaatcgtgctgattggcgcgcacctggattcgtgggac
gtgggcacgggcgcgcatgacgacggcgcgggcgtggtgatggtgatggaggccgcgcgc
ctcatcgcgaagctgccgcaggcgccccggcgcacggtgcgggtggtgctcttcatgaac
gaggagaacggcctgcgcggtgggcgcgcctacgcggaggcgcacgcggcggagttgccc
cggcacgtgggcgcgctggagatggacgcgggcggcgggcggcccgtgagcgtcagcgtg
cgcgcgggcgagggcgggcaggacctgctgcgcccgtggctgccgccgctgacggcgctg
ggggtgacgcagttctccgcgcgcgaggcgggtggggcggacatcagcccgctgatgccc
gcgcgcgtgcccttcttcggcgtggaggtggacagcagccgctacttcgacgtgcaccat
acggaggcggacacgctggacaaggtggacccgcaggacctggcgcgcagcaccgccgcc
gtggcgtggatgacgtacgcgctggcggagatgcccggcacgctcacgcgccccgaggcg
ccggcaccgcgtgggcccgcgccggtaaccgtgcccgcgcagcagtcgaagacctcaggg
aactaa

DBGET integrated database retrieval system