KEGG   Myxococcus xanthus: MXAN_0101Help
Entry
MXAN_0101         CDS       T00366                                 

Definition
(GenBank) hypothetical protein
Organism
mxa  Myxococcus xanthus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
116347..117471
Genome map
AA seq 374 aa AA seqDB search
MDSTAEFRDAFWKQDLRLPRGVELLRQDVFLLPRRGPGGQAIYELAEVVLPQVRVPVLMA
YRAPLLPADVHSLRERLRAASVALDQRDGTAERLPVVRIPMIATDSASSGVIAACEQEDV
ALVDQRGTFFLRSGSTFIRVQGREPSQRRPREPVFHGKGCRIVRTLLQSPGEAQTVRALS
ERTQTSYSYAYGVVRHLVLDGYVEPVGKRSGFRLRAPVRLLRAWMASGEKTSVTLDGFNA
PSTTPELLGKGLERLKAQGIRGIYTLASALLPEERFVSGLPHGLYLTGSIDAAVEAFGLR
RLMPHNFWVLRAEPSAETDAGGVFFSPRTLPHGLGVALPQLTVDFHQSGGRGKEQADELV
QRFAQALPISEEAP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggactcgactgcggagtttcgagacgcattctggaagcaggacctccggttacctcgg
ggggtggaactcctgcgccaagacgtcttcttgttgccgcgccgagggcctggtgggcag
gcgatctatgaactcgccgaggtggtcctcccccaggtccgagtgccggtcctgatggcc
taccgcgcgccgttgctcccggcggacgtgcactcacttcgggaacgcctgcgcgcagcg
agcgtggcgctggaccagcgggatgggaccgccgagcgcctgcccgttgtccgcatcccg
atgattgcgacggattccgcgtcatctggagtcatcgcggcctgcgagcaagaagacgtc
gcattggtcgatcagcgaggaacattcttcctgcgctcaggcagcaccttcattcgtgta
caggggcgcgaaccgtcacagcggcgtccccgtgagccggtattccacgggaaggggtgc
cgcatcgtccggaccctgttgcagtcgccgggagaagcgcagacggtccgcgcgttgtcg
gagcggacgcagaccagttactcctatgcgtacggcgtcgtccgccacctcgtgctcgat
gggtatgtcgagccggtcggcaagcggagtgggtttcggctgagggctcccgtgcgcctg
ctgagggcgtggatggcaagtggcgagaagacctccgtgacactggatggtttcaacgca
ccttccaccacgccggagttgttggggaagggccttgagcgattgaaggcccaaggcatt
cggggcatctatacgctggcgagcgccttgctgcctgaagagcgcttcgtgtcggggctg
cctcacgggctctatctcacgggctctatcgacgcggctgtcgaagccttcgggctgcgc
cgtctgatgcctcataacttctgggtgttgcgggcggagccctcggctgagacggatgcc
ggaggggtcttcttttcgccacgaacgcttcctcatggcctgggtgtggcgttgcctcag
ttgaccgtggatttccatcaaagtggggggcgcggcaaggaacaggcggatgagttggtg
cagcgattcgcacaggcgctgcccatctcagaggaagcgccatga

DBGET integrated database retrieval system